PRGDB00049854 (Os12g0485900)

From PRG Wiki
Jump to: navigation, search
Os12g0485900
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 115488595 (NM_001073317)
Gene Class CNL
Domain Type NBS, LRR, LRR, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa (japonica cultivar-group) Os12g0485900 (Os12g0485900) mRNA, complete cds.

DNA Sequence

ATGGTTGCAACAACAGCTATTGTGGGTGCTACCACGGGGGTGATGAAGCCCCTCCTGTCCAAGCTCACCAAGCTGCTGGGCGAAGAGTATGCCAAGCTCAAAGGCGTGCGCAAGCAGATCAAGTTCTTGATAGATGAGTTGAGCACCATGAGTGCTGCACTCGAGATGCTCGCGGATTCGGACCAGCAGCTCAACCCAGAAATGAGGGATTGGAGGGACAAGCTACGCGAGCTGGCCTATGACCTGGAAGATTGCATCGATGATTTTATGTCTCGTGTTGACCATGATGGGGAAAAGATGGGCTTCAGGAAATTCTTCCGTAAGTTGAAGAAACTGAAGGCGCGCCATGAGATTGCCAATGAGATCGAAGAGCTCAAGATCCGTGCGATCGAGGCAAGCGAAAGGCACAAGAGGTATAATTTTGACCAATTAGCACACAACTCTAGCACTTTTGGCATTGATCCTAGGCTGTCGGCGTTCTATGAGGAGGTTGATAAACTTGTGGGCATTGATGGTCCTAAGAAGCGTATCATTGAGCTGCTAGCTATGGAGATGAAAGGGTCTCTAAAAGTGGTCTCTATTGTTGGTTGTGGAGGTCTTGGTAAGACTACTCTTACAAACCAAGTTTATGACACAATTCGAAGCCAATTTTCTTGTGCAGCTTTTGTGTCAGTTTCACAAAGGCCTGATATAAAGAAGATTCTAAACGATATTGCTGAAGGAGTAGGGATCTCTTCTCGTACTCCGGTTGGTAATGATGAAAAGAAACTCATTAATATACTCCGAGAGCATCTCAAGAATAAAAGATACTTTGTTGTGATTGATGATTTATGGGATGCGAAAGCATGGAAAATTATCGAGCTTGCATTATTAAACAATAATTGTGGCAGCAGAATAATCACTACAACACGAAGCGTTACAGTTGCATCATGTTGTTCTTCTCAAGTTGGTTATATTTATGAGATGAAGCCTCTTAGTTTCAATGAATCCAAATGGTTATTTTTGAAAAGAACATTTGATTATGAAAATTCACATTATCCTCATCCAGAAAATATTTTGGATAAGATATTACGAAAATATGGTGGCCTACCATTGGCAATCATTACTATATCTAGCTTGTTATTAGATCAGCATGAAATTGATGAATGGCATAGGGTACTTAATACTATTGGTTGTGGACTTGCAAATGATCCTAATGCAGAGACAATGTCAAATATATTATCACTGAGTTTCTTCAATCTCCCTCACTATCTAAAAACTTGCTTCATGTACCTGAGTGTATTTCCAGAAGATCGTAAGATTAAGAAACGGCATTTGGTTAGCAAATGGATTGCTGAAGGATTCATTCATAGACACATAAAGGCCATAGGCGCTCGATCGTATGCTGCCTCGATCCGGCCTCGATCGATCGGCGCCTCAGCAGCAGCAGCAGCAGTAGCAGCAGTTGGTCGGCCTCGGCCAGATGGTTATATTTATGAGATGAAGCCTCTTAGTTTCGATGACTCCAAATGGTTATTTTTGAAAAGAGCATTTGGTTATGAAAAATCACATTATCCTCATCTGGAAGATGTTCTGGATAAGATACTAGGAAAATGTGGTGGCCTACCATTGGCAATCATTACTATATCTAGCTTGTTATCATATCAGCATGCTATTGATGAATGGCATAGGGTACTTAATGATATTGGTTATGGACTTGCAAGGGATCCTTATGCAGAGACAATGTCAAATATATTATCGCTGAGTTTCTTCAATCTCCCTCACCATCTAAAAACTTGCTTCATGTACCTAAGTGTATTTCCAGAAGATTATAATATTGACAAACGACGTTTGGTTAGTAAATGGATTGCTGAAGGATTCATTCAGGATGAACAAGGGCGAAGTGCATATAGAACTGGTGAGTTGTATTTTAATGAGCTCATCAATAGAAGCCTGATTGAACCTGTTGATGTAAAGTATGGTCAGGCAAAGGCATGTCGAGTTCATGACATCATTCTTGACTACATCAAATGCAAGGCTACTGAAGAGAACTTTGTCACCTCATTAGGATCTACAGTGCCTGGATGCACTACAGAGTATAAGGTTCGGAGGCTGTCAGTCATCAACAGCAATGAAGAAGATGTCAACATACCGACAAGCCTAGATCTGTCTCAAGTACGATCACTTACTATATTTGGAAATCGCATGCAAACTTCTGTATTTGATTTCAAGTTTCTTCGTGTGTTGGACCTAGTATATAGGGACAGAATGGGTGACCTTTTTGCAAATATTGAAAAATTGTTTCATCTGAAGTACATGTGTATCTCCTCATATGGAGTGGATTATCTCCCAGAAAAAATTGGAGAACTGAAATATTTAGAAACGCTGGACATAAGACAAACCAATGTGGAGATATTGCCATCAACTATCACAAACCTTCAACGACTAGCTCGTCTATTTATCAATCAGGACACGAGATTTTCAGATGAAACGACTATTGGACAATTGAAGAGCCTGGAAGAGCTAAAAGAATTTGTAGTGTCTCAGTCTGAACAAGTGACGGCCCTCCAGGAAGTCAGTAAGCTAACCAAGCTAAGGACATTAAAATTAACACTGCAGTCACCATTGTCACTTGATGATTACCATAGTTGTGTGGGAACATTATTGCAATCTTTATGCAACCTTTATGATTTGTGCATCATGGACCAATCTTATGAAAATTATTGTCTTACGTTGGATTCATGGCACATTGCTTCTCCTTGTAGCCTTCGTAAGCTTGTAATCAAACTAGTACTCACCAAGGTGCCAAATTGGATGGGTGTGCTTGGAAATATTGGAGTACTAGTTCTAGGTATCCTGTGTATAGCACCAGATGATATTGAGATACTTGGAGCAATACCCAGCTTGCTTTTTCTCGAGCTACAAACTTACGGAGGCACCAATGGAAGGATCATCATCCATGGAAACAACAGATTCATAAGTTTGAAATATTTCTCCTTGGTTATTCATGCTTGTGGGACTGCATTGGAGTTTGAAGCAGGATCAATGCCAAAGGTTGAGCACCTCAAGCTTCAGTTTCATCTGCATGAATTGGAATGCCTGAATGGTTCTTCTGACTCAGGCATCCAACACCTCTCTGCTCTCGGCAAGGTTGAGGTCAAAATTATATGCAAACCCTCTTATGTCATTGAATTGAATGGTTTGAACTATGATCTGATGGAACAAAAGAGTGATTGCATCGTCAGATGTGTAGCAAGAACCATTAAAACTGCTGTTGAGACACTCCCCAACCATCCCACTATCAGTTTCAAAACATATCATGTCGAGGAATGTGAACATTTTGAAACAAAAATTGAAGAGAAGCAGACAGCGCAAGCACAGCGGGACCGTCATCTAGGAATCTTATGTATGGCACCAGAAGATATTGAGATCCTTGGAGCAATACCCAGCTTGGTTTTTCTCAAACTAGAAACTCTCGGAGGCACCAATGGAAGGATCATCATCCATGGAAACAACAGATTCATAAGTTTGAAATATTTCTCCTTGGCTATCGGTGCCTGTGGGACTGCACTGGAGTTTGAAGAAGGATCAATGCCAAAGGTTGAGCACCTCAAGCTTGATTTTCGTCTGCACGAATTGGAATGCCTGAATGGTGCTTCTGACTTAGGCATCCAACACCTCTCTGCTCTATGCAAGGTTGAGGTCGAAATTAATTGCAATTGCTTCAAGCACACGTCCAATTTCTTCGATGACTTTGAATTGAAATGTTTGAACTATGATCTGATGGAAGAAACGAGTGATTGCATCGTCAGATGTGTTGCAATAACCATTAAATCTGCCGTTGATACACTCCCCAACCATCCAACTATCAGTTTCCAAATAAACATTTCGAATTGGATGGAAGCCTTTGTGAGATGA


Protein sequences

Name Description Sequence
hypothetical protein Os12g0485900 [Oryza sativa (japonica cultivar-group)].

MVATTAIVGATTGVMKPLLSKLTKLLGEEYAKLKGVRKQIKFLIDELSTMSAALEMLADSDQQLNPEMRDWRDKLRELAYDLEDCIDDFMSRVDHDGEKMGFRKFFRKLKKLKARHEIANEIEELKIRAIEASERHKRYNFDQLAHNSSTFGIDPRLSAFYEEVDKLVGIDGPKKRIIELLAMEMKGSLKVVSIVGCGGLGKTTLTNQVYDTIRSQFSCAAFVSVSQRPDIKKILNDIAEGVGISSRTPVGNDEKKLINILREHLKNKRYFVVIDDLWDAKAWKIIELALLNNNCGSRIITTTRSVTVASCCSSQVGYIYEMKPLSFNESKWLFLKRTFDYENSHYPHPENILDKILRKYGGLPLAIITISSLLLDQHEIDEWHRVLNTIGCGLANDPNAETMSNILSLSFFNLPHYLKTCFMYLSVFPEDRKIKKRHLVSKWIAEGFIHRHIKAIGARSYAASIRPRSIGASAAAAAVAAVGRPRPDGYIYEMKPLSFDDSKWLFLKRAFGYEKSHYPHLEDVLDKILGKCGGLPLAIITISSLLSYQHAIDEWHRVLNDIGYGLARDPYAETMSNILSLSFFNLPHHLKTCFMYLSVFPEDYNIDKRRLVSKWIAEGFIQDEQGRSAYRTGELYFNELINRSLIEPVDVKYGQAKACRVHDIILDYIKCKATEENFVTSLGSTVPGCTTEYKVRRLSVINSNEEDVNIPTSLDLSQVRSLTIFGNRMQTSVFDFKFLRVLDLVYRDRMGDLFANIEKLFHLKYMCISSYGVDYLPEKIGELKYLETLDIRQTNVEILPSTITNLQRLARLFINQDTRFSDETTIGQLKSLEELKEFVVSQSEQVTALQEVSKLTKLRTLKLTLQSPLSLDDYHSCVGTLLQSLCNLYDLCIMDQSYENYCLTLDSWHIASPCSLRKLVIKLVLTKVPNWMGVLGNIGVLVLGILCIAPDDIEILGAIPSLLFLELQTYGGTNGRIIIHGNNRFISLKYFSLVIHACGTALEFEAGSMPKVEHLKLQFHLHELECLNGSSDSGIQHLSALGKVEVKIICKPSYVIELNGLNYDLMEQKSDCIVRCVARTIKTAVETLPNHPTISFKTYHVEECEHFETKIEEKQTAQAQRDRHLGILCMAPEDIEILGAIPSLVFLKLETLGGTNGRIIIHGNNRFISLKYFSLAIGACGTALEFEEGSMPKVEHLKLDFRLHELECLNGASDLGIQHLSALCKVEVEINCNCFKHTSNFFDDFELKCLNYDLMEETSDCIVRCVAITIKSAVDTLPNHPTISFQINISNWMEAFVR

Domains

Domain Start-End Description Sequence

Seg: seg
2-14 seg

VATTAIVGATTGV

HMMPanther: PTHR23155:SF226
11-1275 OS12G0485900 PROTEIN,OS12G0485900 PROTEIN

TTGVMKPLLSKLTKLLGEEYAKLKGVRKQIKFLIDELSTMSAALEMLADSDQQLNPEMRDWRDKLRELAYDLEDCIDDFMSRVDHDGEKMGFRKFFRKLKKLKARHEIANEIEELKIRAIEASERHKRYNFDQLAHNSSTFGIDPRLSAFYEEVDKLVGIDGPKKRIIELLAMEMKGSLKVVSIVGCGGLGKTTLTNQVYDTIRSQFSCAAFVSVSQRPDIKKILNDIAEGVGISSRTPVGNDEKKLINILREHLKNKRYFVVIDDLWDAKAWKIIELALLNNNCGSRIITTTRSVTVASCCSSQVGYIYEMKPLSFNESKWLFLKRTFDYENSHYPHPENILDKILRKYGGLPLAIITISSLLLDQHEIDEWHRVLNTIGCGLANDPNAETMSNILSLSFFNLPHYLKTCFMYLSVFPEDRKIKKRHLVSKWIAEGFIHRHIKAIGARSYAASIRPRSIGASAAAAAVAAVGRPRPDGYIYEMKPLSFDDSKWLFLKRAFGYEKSHYPHLEDVLDKILGKCGGLPLAIITISSLLSYQHAIDEWHRVLNDIGYGLARDPYAETMSNILSLSFFNLPHHLKTCFMYLSVFPEDYNIDKRRLVSKWIAEGFIQDEQGRSAYRTGELYFNELINRSLIEPVDVKYGQAKACRVHDIILDYIKCKATEENFVTSLGSTVPGCTTEYKVRRLSVINSNEEDVNIPTSLDLSQVRSLTIFGNRMQTSVFDFKFLRVLDLVYRDRMGDLFANIEKLFHLKYMCISSYGVDYLPEKIGELKYLETLDIRQTNVEILPSTITNLQRLARLFINQDTRFSDETTIGQLKSLEELKEFVVSQSEQVTALQEVSKLTKLRTLKLTLQSPLSLDDYHSCVGTLLQSLCNLYDLCIMDQSYENYCLTLDSWHIASPCSLRKLVIKLVLTKVPNWMGVLGNIGVLVLGILCIAPDDIEILGAIPSLLFLELQTYGGTNGRIIIHGNNRFISLKYFSLVIHACGTALEFEAGSMPKVEHLKLQFHLHELECLNGSSDSGIQHLSALGKVEVKIICKPSYVIELNGLNYDLMEQKSDCIVRCVARTIKTAVETLPNHPTISFKTYHVEECEHFETKIEEKQTAQAQRDRHLGILCMAPEDIEILGAIPSLVFLKLETLGGTNGRIIIHGNNRFISLKYFSLAIGACGTALEFEEGSMPKVEHLKLDFRLHELECLNGASDLGIQHLSALCKVEVEINCNCFKHTSNFFDDFELKCLNYDLMEETSDCIVRCVAITIKSAVD

HMMPanther: PTHR23155
11-1275 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

TTGVMKPLLSKLTKLLGEEYAKLKGVRKQIKFLIDELSTMSAALEMLADSDQQLNPEMRDWRDKLRELAYDLEDCIDDFMSRVDHDGEKMGFRKFFRKLKKLKARHEIANEIEELKIRAIEASERHKRYNFDQLAHNSSTFGIDPRLSAFYEEVDKLVGIDGPKKRIIELLAMEMKGSLKVVSIVGCGGLGKTTLTNQVYDTIRSQFSCAAFVSVSQRPDIKKILNDIAEGVGISSRTPVGNDEKKLINILREHLKNKRYFVVIDDLWDAKAWKIIELALLNNNCGSRIITTTRSVTVASCCSSQVGYIYEMKPLSFNESKWLFLKRTFDYENSHYPHPENILDKILRKYGGLPLAIITISSLLLDQHEIDEWHRVLNTIGCGLANDPNAETMSNILSLSFFNLPHYLKTCFMYLSVFPEDRKIKKRHLVSKWIAEGFIHRHIKAIGARSYAASIRPRSIGASAAAAAVAAVGRPRPDGYIYEMKPLSFDDSKWLFLKRAFGYEKSHYPHLEDVLDKILGKCGGLPLAIITISSLLSYQHAIDEWHRVLNDIGYGLARDPYAETMSNILSLSFFNLPHHLKTCFMYLSVFPEDYNIDKRRLVSKWIAEGFIQDEQGRSAYRTGELYFNELINRSLIEPVDVKYGQAKACRVHDIILDYIKCKATEENFVTSLGSTVPGCTTEYKVRRLSVINSNEEDVNIPTSLDLSQVRSLTIFGNRMQTSVFDFKFLRVLDLVYRDRMGDLFANIEKLFHLKYMCISSYGVDYLPEKIGELKYLETLDIRQTNVEILPSTITNLQRLARLFINQDTRFSDETTIGQLKSLEELKEFVVSQSEQVTALQEVSKLTKLRTLKLTLQSPLSLDDYHSCVGTLLQSLCNLYDLCIMDQSYENYCLTLDSWHIASPCSLRKLVIKLVLTKVPNWMGVLGNIGVLVLGILCIAPDDIEILGAIPSLLFLELQTYGGTNGRIIIHGNNRFISLKYFSLVIHACGTALEFEAGSMPKVEHLKLQFHLHELECLNGSSDSGIQHLSALGKVEVKIICKPSYVIELNGLNYDLMEQKSDCIVRCVARTIKTAVETLPNHPTISFKTYHVEECEHFETKIEEKQTAQAQRDRHLGILCMAPEDIEILGAIPSLVFLKLETLGGTNGRIIIHGNNRFISLKYFSLAIGACGTALEFEEGSMPKVEHLKLDFRLHELECLNGASDLGIQHLSALCKVEVEINCNCFKHTSNFFDDFELKCLNYDLMEETSDCIVRCVAITIKSAVD

Seg: seg
102-113 seg

FRKFFRKLKKLK

Coil: coil
115-136 coiled-coil

RHEIANEIEELKIRAIEASERH

superfamily: SSF52540
150-397 P-loop containing nucleoside triphosphate hydrolases

TFGIDPRLSAFYEEVDKLVGIDGPKKRIIELLAMEMKGSLKVVSIVGCGGLGKTTLTNQVYDTIRSQFSCAAFVSVSQRPDIKKILNDIAEGVGISSRTPVGNDEKKLINILREHLKNKRYFVVIDDLWDAKAWKIIELALLNNNCGSRIITTTRSVTVASCCSSQVGYIYEMKPLSFNESKWLFLKRTFDYENSHYPHPENILDKILRKYGGLPLAIITISSLLLDQHEIDEWHRVLNTIGCGLAND

Gene3D: G3DSA:3.40.50.300
170-305 no description

IDGPKKRIIELLAMEMKGSLKVVSIVGCGGLGKTTLTNQVYDTIRSQFSCAAFVSVSQRPDIKKILNDIAEGVGISSRTPVGNDEKKLINILREHLKNKRYFVVIDDLWDAKAWKIIELALLNNNCGSRIITTTRS

HMMPfam: PF00931
IPR002182
174-450 NB-ARC,NBS
NB-ARC

KKRIIELLAMEMKGSLKVVSIVGCGGLGKTTLTNQVYDTIRSQFSCAAFVSVSQRPDIKKILNDIAEGVGISSRTPVGNDEKKLINILREHLKNKRYFVVIDDLWDAKAWKIIELALLNNNCGSRIITTTRSVTVASCCSSQVGYIYEMKPLSFNESKWLFLKRTFDYENSHYPHPENILDKILRKYGGLPLAIITISSLLLDQHEIDEWHRVLNTIGCGLANDPNAETMSNILSLSFFNLPHYLKTCFMYLSVFPEDRKIKKRHLVSKWIAEGFIH

FPrintScan: PR00364
IPR000767
191-206 DISEASERSIST
Disease resistance protein

VVSIVGCGGLGKTTLT

FPrintScan: PR00364
IPR000767
264-278 DISEASERSIST
Disease resistance protein

HLKNKRYFVVIDDLW

Seg: seg
462-487 seg

AASIRPRSIGASAAAAAVAAVGRPRP

superfamily: SSF52540
489-569 P-loop containing nucleoside triphosphate hydrolases

GYIYEMKPLSFDDSKWLFLKRAFGYEKSHYPHLEDVLDKILGKCGGLPLAIITISSLLSYQHAIDEWHRVLNDIGYGLARD

HMMPfam: PF00931
IPR002182
490-625 NB-ARC,NBS
NB-ARC

YIYEMKPLSFDDSKWLFLKRAFGYEKSHYPHLEDVLDKILGKCGGLPLAIITISSLLSYQHAIDEWHRVLNDIGYGLARDPYAETMSNILSLSFFNLPHHLKTCFMYLSVFPEDYNIDKRRLVSKWIAEGFIQDEQ

FPrintScan: PR00364
IPR000767
532-546 DISEASERSIST
Disease resistance protein

CGGLPLAIITISSLL

superfamily: SSF52058
660-1063 L domain-like,LRR

RVHDIILDYIKCKATEENFVTSLGSTVPGCTTEYKVRRLSVINSNEEDVNIPTSLDLSQVRSLTIFGNRMQTSVFDFKFLRVLDLVYRDRMGDLFANIEKLFHLKYMCISSYGVDYLPEKIGELKYLETLDIRQTNVEILPSTITNLQRLARLFINQDTRFSDETTIGQLKSLEELKEFVVSQSEQVTALQEVSKLTKLRTLKLTLQSPLSLDDYHSCVGTLLQSLCNLYDLCIMDQSYENYCLTLDSWHIASPCSLRKLVIKLVLTKVPNWMGVLGNIGVLVLGILCIAPDDIEILGAIPSLLFLELQTYGGTNGRIIIHGNNRFISLKYFSLVIHACGTALEFEAGSMPKVEHLKLQFHLHELECLNGSSDSGIQHLSALGKVEVKIICKPSYVIELNGLNY

Gene3D: G3DSA:3.80.10.10
708-921 no description

VNIPTSLDLSQVRSLTIFGNRMQTSVFDFKFLRVLDLVYRDRMGDLFANIEKLFHLKYMCISSYGVDYLPEKIGELKYLETLDIRQTNVEILPSTITNLQRLARLFINQDTRFSDETTIGQLKSLEELKEFVVSQSEQVTALQEVSKLTKLRTLKLTLQSPLSLDDYHSCVGTLLQSLCNLYDLCIMDQSYENYCLTLDSWHIASPCSLRKLVI

FPrintScan: PR00364
IPR000767
853-869 DISEASERSIST
Disease resistance protein

SKLTKLRTLKLTLQSPL

Seg: seg
854-865 seg

KLTKLRTLKLTL

Seg: seg
933-948 seg

GVLGNIGVLVLGILCI


List of References




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox