PRGDB00049855 (Os12g0481400)

From PRG Wiki
Jump to: navigation, search
Os12g0481400
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 115488571 (NM_001073305)
Gene Class NL
Domain Type LRR, NBS, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa (japonica cultivar-group) Os12g0481400 (Os12g0481400) mRNA, complete cds.

DNA Sequence

ATGGAGTTCACCGTCAGCGCAGCACGGTGGGTGGTGGGCAGGGCGCTGGGCCCCGTCACCGGCGAGCTGATGGAGGCATGGGCGGCGAGCAAGAAGCTTGGCCCCAACATCCGCGAGCTCAAGCTCCTGCTCCTCCATGCGCAGGCGATGCTCGAAAATGCCGAGGGCCGGGACATCCGTAACGGTGCACTGGATCAGCTGCTGTCTCAGCTCCGGGACCTGGCGTACGACGCCGACGACGTGCTGGACGAGCTCGACTACTTCCGCATCCAGGATGAGCTCGATGGCACGTACGAGGCGGTCGACGACGCCGAGGAGGAGAGGGGCCTTGTCCGTGGCCTCGCCCTGCACGCTCGCCACACCGCGAGAGCCATCGCCAGAAAGCTGACGTGCAAGTGGAATGCCGATGCTCTGGTACCTGTTGACGACGCAGAACAAGGGCGATGCCTCTCTGCCACTGCTGTCGGTAAATTCCTCCCTTGCTGCTCCCCCCCAACTGTGCGTAATGTTGATTCCACTGCTGCGAAGGCAAATGAACAGCATCTCCAAGCCCCTAAATTGAAGTTTGTTAGGGTTGAAATGTCGAAAAAGATGTCAGAGATAGTAGAGCAGCTTAAGCCTGTTTGTGACGCTGTTGACAGAATTCTTGGGCCACTACAGCCTTCAGGCCACTCCAAAAATGCCAAAACCCAATGCATTGATTTAGAAAAACGACCTAAAACCACCCCAACAATTATTGAGCCTGAATTATTTGGAAGGAAAGACCTTAAAAGGATCGTGGCAGATGAAATTATGATTGGCAAATACCGTGATAATGACCTTACCGTGCTTCCCATTGTTGGTCCGGGTGGTATCGGGAAGACAACTTTTACACAACACATATATGAAGAAGTGAAGAACCACTTTCAGATCTCCGTCTGGATATGTGTTTCTCAAAATTTCAATGCAAATGTATTAGCAAAGGAGATTGTAGAAAAAATGCCTAAGGGAAACAACAAAAAGGAAAATGAAAGTGACCAAGAGAAAATTGAGAAAAGAATACAATCACAGCAATTCTTGCTTGTCTTGGATGATGTGTGGGAATATCGTGAGGATGAGTGGAAAACCTTACTGGCTCCATTTAGAAAAGGAGGAACACAAGGAAATATAGTTATAGTTACAACTCGAAGGCCAGGGGTAGCAAAGGAGATCGACTCAACCAATTGCTCAATAAAATTGGACCGCTTGGATCATGAAGATTCTATGCGGTTATTCCAGGCATGTGTGTTTGATAACAACAAGACATGGGAAGATTATCCATCGGGTTTACAGAAAGTTGGGGTAGACATAGTGAAGAGATTGAAGGGTTTCCCTCTTGCTATAAAAACCGTAGGTCGGTTATTAAGGAATAAACTTACTTTGGACCGATGGACTAGAGTATATGAAAGTAAAGAATGGGAACTTCAGTCCAATGATGATGATATTATGCCGGCATTAAAGTTAAGCTATAACTATCTTCCTTTTCATCTACAACAGTGTTTCTCCTATTGTGCTTTGTTTCCTGAAGATTATAGATTTTGTGGACAAGAATTGATTAACTTGTGGATTGGACTGGGGTTACTTGGCACCGATGATCAAAACAAGACAATGGAGTATTTAGGACTAGAGTATTTAGACCAATTGGTTGACAATGGGTTTTTCGAACAGGTTGGAAAAGAGCATGACAGTCCTTATGTAATGCATGACCTGTTGCATGAGTTGGCAACAAATATTTCGTCACACGAAATTCGTTGTCTAAATAGTTCAACTTTGAGTTCTATCAACGAAATTCCCAAATCTATACGTCACATGTCTATCATAGTAGATAACAGACATGTTGAGAATAGAATCGCCTTTGAAAATCATAAGAAAGACCTGAGTACACTGGGAAACAAATTGAAAGCTGGGAACCTACGCACAATTATGCTTTTTGGAGAATATCATGGATGCTTTTACAAGATTTTTGGTGACGTTTTGATAGATGCAAAATCCCTTCGGGTTATTTTTTTGTCAGGGGCATCCTATGATGTTGGAGATGTGTTGTGTAACTTTTCAGAACTTGTACATCTTCGGTACTTAAGGATTGAAGATTCTGGGATGTGTGGAGCAAGTCTACCCAATAGTATCACAAGATTTTACCACTTATTGGTCCTTGATTTACAAGAGCACTATGGTGAATTGGGTTTTCCAAGGGACATGGGAAACCTTCTAAAACTACGCCATTTTCTTGTCCATGATGATAATATTCACTCTAGCATTTTTGAGGTGGGAAAACTAAATTTTTTACATGAGTTACGGAAGTTTGAGGTCAAAAGAGAAATGAAAGGTTTTGACTTGGAGCAAATTGGGCGACTACTAGTACTCCGTGGGTCACTGGGCATTTATAACCTTGAAAAGGTTGAAGGGATCAAGGAAGCAAATGATGCAAAACTAGCATATCTAAACCATTTGGATAGTTTAGTATTGGATTGGGATAATGAGCGATGTAATAGGGATCCTATCAGAGAAGGAAATGTTCTTGAAAATCTTAAACCACATGACAACATTCGAGAGCTGCACATTGCAGGGCATGGAGGCGTATCTTGCCCGAATTGGCTAAGTGGAGACCTCTCCATTAGAAATTTGGAATCACTTCTGATAAAATATGTAAATTGGGACACATTTCCACTTCCAGGAAAGTTGTACATGACTGAGGGTCAAGAGCGTCAGGGTTCTGTCACAAGCCACGACTTTCATAATCTGAAAAGGTTGGAGCTAGTTAACATACAAAAGCTGAAAAGATGGCATGGGGATGGTACCATTAATTTGCTCCCTCATTTGCAAAGTTTAACTATAAGTGATTGCCCTGAATTAACAGAGTTGCCACTATCAGATTCCACATCCTGTCAGTTTCAACAGAGCACGATTTGTTTTCCTAAACTACAGGAAATCAAGATTTCAGAATGTCCGAAATTGTTGTCATTCCCCCCTATACCTTGGACTAATTCTCTGTTGTATGTATCTATTGAAGGTGTGGATTCAGGTTTGGAGATGTTGAATTACAGTAAAGACGAATCAAGTCTGTATATCACAGGAAAAGATGCTCCGGATAGCATGTTTTGGAACGTGCTGGATTTCAATAATCTAACAGAACTGCAATTGTTGGGGATACAAAAGTGTCCTCCTATATCGTTGGATCACCTTAAAATGCTGACATGTCTCAAGACCCTTCAGATAACTGATTCAGGTAGCATATTGTTGCCAGTTGATTGTGAAAACGAAGTTAAGTATAATCTTTTAGTTGAGAATCTCGAGATCAATTCATATGGTGCTAGTGGGAGGGAATTGACACAGGTGCTCTCTCATTTTCCCAAACTATCAAATTTGCTGATACGGAAATGTCAGAACGTAGCAAGGCTCGGTGTGGCGGAGCAGCGAACAATAACAACTCCTGAATCATCACTATCACCATCAGCTAACAAAGCAGCCAAGACACTAACCACAATACTGCAGCAGCAGACAGGAGAAGCGGAGGAGATGGAAACAGCAACAGCAGACGATGGACTACTTCTCCTGCCTCCCCAAATAAAGGTGTTTGAAATCAGTGAGTGCAGAGAGCTAAGCCTCGACAGCGGTGGAATCCAAGGTCTGCTCTCCCTCCAAACGTTGGGGATATATGATTGCCCCAAGCTCCTCTGCTCCTCTTCCTCCTCGTATTCCCCTTTCCCGACCTCCCTGCAAACACTCGATCTCTCGAAAGTGGAGGGCATGGAGACCCTGCCTTCTCCTCTCCCAAACCTCACCTCGTTGTCGATTACCAGTTGCGGCAATCTCAGAGGGGGCGAGGTGCTGTGGGATCTCCTTGCCCAAGGTAACCTCACCTCTCTATATGTCCACAAAACTCCCAATTTCTTCCTTGGTTTAGAGCAGTCCTGCTCCCAGGTGGACAAACAAGAAGACGTGCATCGTTCCTGGAGGTTGCAGGAACTCTGGACGGATGACTTTGCAAGGGTTCTTGCTACACCTGTTTGCCATCTCCTCTCTTCCTCCCTAACCAAATTAGTCCTTAGTTGCAACGATGAGGTGGAGTGCTTCACAAAGGAGCAAGAGAAGGCCCTTCACATTCTCACCTCCATTGAGGACCTAGAATTTTATTGCTGCGAAAAACTGCAGTCCCTCCCTGCTGAGCTTAGTCAAATCCCCACCATCAAGACATTATGGATTTCTTGCTGTCCAGCCATCAGCTCGCTTGGAAACCTCCCCAATTCACTGCAACGACTAGGGATTTCTTGCTGTCCAGCCATCAGCTCGCTTGGAAACCTCCCCAATTCACTGCAACAACTAAAGATTGATGACTGTCCATCCATCAGCTCGCTTGATGGCACAACCATCCGCTCACTGCCCAAAGACCGCCTACCAACTACACTCCGAGAAATAGACGTCCGTTACTGTCGCAACGAGGAGCTAAAAAGGCAGTGCCGGAAGCTTCAAGGAACTATCCCAATTGTAAAGGCCTAG


Protein sequences

Name Description Sequence
hypothetical protein Os12g0481400 [Oryza sativa (japonica cultivar-group)].

MEFTVSAARWVVGRALGPVTGELMEAWAASKKLGPNIRELKLLLLHAQAMLENAEGRDIRNGALDQLLSQLRDLAYDADDVLDELDYFRIQDELDGTYEAVDDAEEERGLVRGLALHARHTARAIARKLTCKWNADALVPVDDAEQGRCLSATAVGKFLPCCSPPTVRNVDSTAAKANEQHLQAPKLKFVRVEMSKKMSEIVEQLKPVCDAVDRILGPLQPSGHSKNAKTQCIDLEKRPKTTPTIIEPELFGRKDLKRIVADEIMIGKYRDNDLTVLPIVGPGGIGKTTFTQHIYEEVKNHFQISVWICVSQNFNANVLAKEIVEKMPKGNNKKENESDQEKIEKRIQSQQFLLVLDDVWEYREDEWKTLLAPFRKGGTQGNIVIVTTRRPGVAKEIDSTNCSIKLDRLDHEDSMRLFQACVFDNNKTWEDYPSGLQKVGVDIVKRLKGFPLAIKTVGRLLRNKLTLDRWTRVYESKEWELQSNDDDIMPALKLSYNYLPFHLQQCFSYCALFPEDYRFCGQELINLWIGLGLLGTDDQNKTMEYLGLEYLDQLVDNGFFEQVGKEHDSPYVMHDLLHELATNISSHEIRCLNSSTLSSINEIPKSIRHMSIIVDNRHVENRIAFENHKKDLSTLGNKLKAGNLRTIMLFGEYHGCFYKIFGDVLIDAKSLRVIFLSGASYDVGDVLCNFSELVHLRYLRIEDSGMCGASLPNSITRFYHLLVLDLQEHYGELGFPRDMGNLLKLRHFLVHDDNIHSSIFEVGKLNFLHELRKFEVKREMKGFDLEQIGRLLVLRGSLGIYNLEKVEGIKEANDAKLAYLNHLDSLVLDWDNERCNRDPIREGNVLENLKPHDNIRELHIAGHGGVSCPNWLSGDLSIRNLESLLIKYVNWDTFPLPGKLYMTEGQERQGSVTSHDFHNLKRLELVNIQKLKRWHGDGTINLLPHLQSLTISDCPELTELPLSDSTSCQFQQSTICFPKLQEIKISECPKLLSFPPIPWTNSLLYVSIEGVDSGLEMLNYSKDESSLYITGKDAPDSMFWNVLDFNNLTELQLLGIQKCPPISLDHLKMLTCLKTLQITDSGSILLPVDCENEVKYNLLVENLEINSYGASGRELTQVLSHFPKLSNLLIRKCQNVARLGVAEQRTITTPESSLSPSANKAAKTLTTILQQQTGEAEEMETATADDGLLLLPPQIKVFEISECRELSLDSGGIQGLLSLQTLGIYDCPKLLCSSSSSYSPFPTSLQTLDLSKVEGMETLPSPLPNLTSLSITSCGNLRGGEVLWDLLAQGNLTSLYVHKTPNFFLGLEQSCSQVDKQEDVHRSWRLQELWTDDFARVLATPVCHLLSSSLTKLVLSCNDEVECFTKEQEKALHILTSIEDLEFYCCEKLQSLPAELSQIPTIKTLWISCCPAISSLGNLPNSLQRLGISCCPAISSLGNLPNSLQQLKIDDCPSISSLDGTTIRSLPKDRLPTTLREIDVRYCRNEELKRQCRKLQGTIPIVKA

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017:SF28
102-884 PTHR11017:SF28

DDAEEERGLVRGLALHARHTARAIARKLTCKWNADALVPVDDAEQGRCLSATAVGKFLPCCSPPTVRNVDSTAAKANEQHLQAPKLKFVRVEMSKKMSEIVEQLKPVCDAVDRILGPLQPSGHSKNAKTQCIDLEKRPKTTPTIIEPELFGRKDLKRIVADEIMIGKYRDNDLTVLPIVGPGGIGKTTFTQHIYEEVKNHFQISVWICVSQNFNANVLAKEIVEKMPKGNNKKENESDQEKIEKRIQSQQFLLVLDDVWEYREDEWKTLLAPFRKGGTQGNIVIVTTRRPGVAKEIDSTNCSIKLDRLDHEDSMRLFQACVFDNNKTWEDYPSGLQKVGVDIVKRLKGFPLAIKTVGRLLRNKLTLDRWTRVYESKEWELQSNDDDIMPALKLSYNYLPFHLQQCFSYCALFPEDYRFCGQELINLWIGLGLLGTDDQNKTMEYLGLEYLDQLVDNGFFEQVGKEHDSPYVMHDLLHELATNISSHEIRCLNSSTLSSINEIPKSIRHMSIIVDNRHVENRIAFENHKKDLSTLGNKLKAGNLRTIMLFGEYHGCFYKIFGDVLIDAKSLRVIFLSGASYDVGDVLCNFSELVHLRYLRIEDSGMCGASLPNSITRFYHLLVLDLQEHYGELGFPRDMGNLLKLRHFLVHDDNIHSSIFEVGKLNFLHELRKFEVKREMKGFDLEQIGRLLVLRGSLGIYNLEKVEGIKEANDAKLAYLNHLDSLVLDWDNERCNRDPIREGNVLENLKPHDNIRELHIAGHGGVSCPNWLSGDLSIRNLESL

HMMPanther: PTHR11017
102-884 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

DDAEEERGLVRGLALHARHTARAIARKLTCKWNADALVPVDDAEQGRCLSATAVGKFLPCCSPPTVRNVDSTAAKANEQHLQAPKLKFVRVEMSKKMSEIVEQLKPVCDAVDRILGPLQPSGHSKNAKTQCIDLEKRPKTTPTIIEPELFGRKDLKRIVADEIMIGKYRDNDLTVLPIVGPGGIGKTTFTQHIYEEVKNHFQISVWICVSQNFNANVLAKEIVEKMPKGNNKKENESDQEKIEKRIQSQQFLLVLDDVWEYREDEWKTLLAPFRKGGTQGNIVIVTTRRPGVAKEIDSTNCSIKLDRLDHEDSMRLFQACVFDNNKTWEDYPSGLQKVGVDIVKRLKGFPLAIKTVGRLLRNKLTLDRWTRVYESKEWELQSNDDDIMPALKLSYNYLPFHLQQCFSYCALFPEDYRFCGQELINLWIGLGLLGTDDQNKTMEYLGLEYLDQLVDNGFFEQVGKEHDSPYVMHDLLHELATNISSHEIRCLNSSTLSSINEIPKSIRHMSIIVDNRHVENRIAFENHKKDLSTLGNKLKAGNLRTIMLFGEYHGCFYKIFGDVLIDAKSLRVIFLSGASYDVGDVLCNFSELVHLRYLRIEDSGMCGASLPNSITRFYHLLVLDLQEHYGELGFPRDMGNLLKLRHFLVHDDNIHSSIFEVGKLNFLHELRKFEVKREMKGFDLEQIGRLLVLRGSLGIYNLEKVEGIKEANDAKLAYLNHLDSLVLDWDNERCNRDPIREGNVLENLKPHDNIRELHIAGHGGVSCPNWLSGDLSIRNLESL

superfamily: SSF52540
233-484 SSF52540

IDLEKRPKTTPTIIEPELFGRKDLKRIVADEIMIGKYRDNDLTVLPIVGPGGIGKTTFTQHIYEEVKNHFQISVWICVSQNFNANVLAKEIVEKMPKGNNKKENESDQEKIEKRIQSQQFLLVLDDVWEYREDEWKTLLAPFRKGGTQGNIVIVTTRRPGVAKEIDSTNCSIKLDRLDHEDSMRLFQACVFDNNKTWEDYPSGLQKVGVDIVKRLKGFPLAIKTVGRLLRNKLTLDRWTRVYESKEWELQSN

HMMPfam: PF00931
IPR002182
271-535 NB-ARC,NBS
NB-ARC

DNDLTVLPIVGPGGIGKTTFTQHIYEEVKNHFQISVWICVSQNFNANVLAKEIVEKMPKGNNKKENESDQEKIEKRIQSQQFLLVLDDVWEYREDEWKTLLAPFRKGGTQGNIVIVTTRRPGVAKEIDSTNCSIKLDRLDHEDSMRLFQACVFDNNKTWEDYPSGLQKVGVDIVKRLKGFPLAIKTVGRLLRNKLTLDRWTRVYESKEWELQSNDDDIMPALKLSYNYLPFHLQQCFSYCALFPEDYRFCGQELINLWIGLGLLG

Gene3D: G3DSA:3.40.50.300
272-399 G3DSA:3.40.50.300

NDLTVLPIVGPGGIGKTTFTQHIYEEVKNHFQISVWICVSQNFNANVLAKEIVEKMPKGNNKKENESDQEKIEKRIQSQQFLLVLDDVWEYREDEWKTLLAPFRKGGTQGNIVIVTTRRPGVAKEIDS

FPrintScan: PR00364
IPR000767
276-291 DISEASERSIST
Disease resistance protein

VLPIVGPGGIGKTTFT

FPrintScan: PR00364
IPR000767
346-360 DISEASERSIST
Disease resistance protein

RIQSQQFLLVLDDVW

FPrintScan: PR00364
IPR000767
447-461 DISEASERSIST
Disease resistance protein

LKGFPLAIKTVGRLL

superfamily: SSF52058
572-1012 SSF52058,LRR

VMHDLLHELATNISSHEIRCLNSSTLSSINEIPKSIRHMSIIVDNRHVENRIAFENHKKDLSTLGNKLKAGNLRTIMLFGEYHGCFYKIFGDVLIDAKSLRVIFLSGASYDVGDVLCNFSELVHLRYLRIEDSGMCGASLPNSITRFYHLLVLDLQEHYGELGFPRDMGNLLKLRHFLVHDDNIHSSIFEVGKLNFLHELRKFEVKREMKGFDLEQIGRLLVLRGSLGIYNLEKVEGIKEANDAKLAYLNHLDSLVLDWDNERCNRDPIREGNVLENLKPHDNIRELHIAGHGGVSCPNWLSGDLSIRNLESLLIKYVNWDTFPLPGKLYMTEGQERQGSVTSHDFHNLKRLELVNIQKLKRWHGDGTINLLPHLQSLTISDCPELTELPLSDSTSCQFQQSTICFPKLQEIKISECPKLLSFPPIPWTNSLLYVSIEGVD

Gene3D: G3DSA:3.80.10.10
642-857 G3DSA:3.80.10.10

GNLRTIMLFGEYHGCFYKIFGDVLIDAKSLRVIFLSGASYDVGDVLCNFSELVHLRYLRIEDSGMCGASLPNSITRFYHLLVLDLQEHYGELGFPRDMGNLLKLRHFLVHDDNIHSSIFEVGKLNFLHELRKFEVKREMKGFDLEQIGRLLVLRGSLGIYNLEKVEGIKEANDAKLAYLNHLDSLVLDWDNERCNRDPIREGNVLENLKPHDNIRE

Gene3D: G3DSA:3.80.10.10
858-990 G3DSA:3.80.10.10

LHIAGHGGVSCPNWLSGDLSIRNLESLLIKYVNWDTFPLPGKLYMTEGQERQGSVTSHDFHNLKRLELVNIQKLKRWHGDGTINLLPHLQSLTISDCPELTELPLSDSTSCQFQQSTICFPKLQEIKISECPK

FPrintScan: PR00364
IPR000767
941-957 DISEASERSIST
Disease resistance protein

NLLPHLQSLTISDCPEL

Gene3D: G3DSA:3.80.10.10
1028-1136 G3DSA:3.80.10.10

YITGKDAPDSMFWNVLDFNNLTELQLLGIQKCPPISLDHLKMLTCLKTLQITDSGSILLPVDCENEVKYNLLVENLEINSYGASGRELTQVLSHFPKLSNLLIRKCQNV

Gene3D: G3DSA:3.80.10.10
1193-1411 G3DSA:3.80.10.10

PQIKVFEISECRELSLDSGGIQGLLSLQTLGIYDCPKLLCSSSSSYSPFPTSLQTLDLSKVEGMETLPSPLPNLTSLSITSCGNLRGGEVLWDLLAQGNLTSLYVHKTPNFFLGLEQSCSQVDKQEDVHRSWRLQELWTDDFARVLATPVCHLLSSSLTKLVLSCNDEVECFTKEQEKALHILTSIEDLEFYCCEKLQSLPAELSQIPTIKTLWISCCP

superfamily: SSF52047
1205-1486 SSF52047,LRR

ELSLDSGGIQGLLSLQTLGIYDCPKLLCSSSSSYSPFPTSLQTLDLSKVEGMETLPSPLPNLTSLSITSCGNLRGGEVLWDLLAQGNLTSLYVHKTPNFFLGLEQSCSQVDKQEDVHRSWRLQELWTDDFARVLATPVCHLLSSSLTKLVLSCNDEVECFTKEQEKALHILTSIEDLEFYCCEKLQSLPAELSQIPTIKTLWISCCPAISSLGNLPNSLQRLGISCCPAISSLGNLPNSLQQLKIDDCPSISSLDGTTIRSLPKDRLPTTLREIDVRYCRNE


List of References




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox