PRGDB00049856 (Os12g0477100)

From PRG Wiki
Jump to: navigation, search
Os12g0477100
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 115488537 (NM_001073288)
Gene Class NL
Domain Type LRR, NBS, LRR, LRR, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa (japonica cultivar-group) Os12g0477100 (Os12g0477100) mRNA, complete cds.

DNA Sequence

ATGACTGTGCTATCTGTCTTGGCTTCATCAATACTGTCAAAGGTCACCACGTTTGCTGTTGAATATGCTCTCGACGACATTAAATTTGCTTGGAATGTTAAGAGTGAGCTGGAAAAGTTGAAAAACTCATTGGGAGCTATTTGTGCTGTTCTGAAAGATGCAGAAAGAAAGCAATCTACACACAGTTCACTTAAGCATTGGCTTGAAAATCTCAAAGATGTTGTCTATGACATAGATGATGTTCTGGATGATGTTGGGACACGAGTGTTGCAGCAGAAAGTTAGAAAAGGTGAAATCTGTACTTATTTTGCCCAACTAACCATCTTTCCTTTTGAACTGGGAAGAAAAATAAGAAAGGTCCGTGAAAGGCTAAATGAAATAGCTGCGCTTAAAAGAGATTTTGAATTGAAAGAAGAACCAATAGACACACCTTCAGATCAATTTGCCCAGAGAGAAACACACTCCCTTATAGGCGAGCAAAATATTTTTGGAAGAGATAAAGCTAAAAATGATATTGTCAAGATGATTTCAGAAGCTGCTGAATCTAATTCTAATACCCTGTCAGTGCTTCCACTAATTGGAATGGGAGGTGTAGGCAAGACTGCCCTAGCAAAACTGGTATTTAATGATAAATCAACCAAAGATAAGTTTGATAAGATGCTATGGGCATCTGTATCTAATGCGTTTGACCTAAAACATATTGTAAATATAATCATACAATCAGATAGCGGTGAAAGCAATAACCAATTAACCCTAGAAGCATTAACAAAGAAACTTCATGAGCTTTTAAGGGACAAGAGATACTTGCTAGTGTTAGATGACATATCAAATGATAATGTCAACTGGGAAGAATTGATAAACCTGCTACCGAGTGGTAGAAGTGGATGCATGATTTTAATCACTACACGTCTTACAAAAATTGCATCAGAATTGAAGACATTAGAACCATACGAAGTGCCAAAACTTCCACATGAAGAATGCAGGAAAATATTTGTTCGATATGCTTTCAGAGGAGAAAAGGCGAAGGATAGAGAGTTACTAAAAATTGGAGAATCCATTGTACAGAAATGTGATGGCCTTCCTTTAGCAGCTAGAACATTGGGATCCCTATTGTTCAGAAAAGACATTTCTATGTGGCAAGAAGTAAAGGAAAATAATTTGCTGAGTACTGGGAAAGGTAAAGATGATATCTTGTCAGTATTAAAACTCAGTTATGATGCACTTCCATCTGATTTAAAAACTTGTTTTTCCTGGTTATCCACTTTTCCAAAGGACTATGATATTTTCAGAGAACTTATAATAATGTATTGGATGGCAATGGGTCTATTGAATCCAGCTAGTCGAACTAAGGAGGCAATAAGAGTGGGAGAGAAATACTTTAATGAGCTTGCTGGAAGATCTCTTTTCCAGGACTATGTTTTTAATCATGATGGCAGCATCTCACATTGCAAAATGCATAGCCTTGTTCATGATCTAGCAATATCTGTGTCTCAAAATGAGCATGCAATTGTTGGCTGTGAAAATTTTACTGCCACTGAAAGAGTTAAGAACCTAGTGTGGGACCACAAAGACTTCACAACAGAACTAAAATTTCCAACACAACTGAGAAGGGCAAGAAAGGCTAGGACATTTGCATGTAGGCATAACTATGGTACTGTGAGCAAATCCTTTCTTGAAGATCTCTTAGCAACCTTCACACTCCTAAGAGTCTTGGTTTTCTCTGAAGTTGAGTTTGAGGAGTTACCAAGTTCAATTGGAAATTTGAAGCACCTAAGGTACCTAGACCTTCAATGGAATATGAAGATAAAATTCCTACCCAATTCTCTGTGTAAGCTGGTGAATTTACAAACACTTCAACTCGCTTGGTGCAAAGAACTGGAGGAGCTGCCAAAAGATGTGAAAAGACTTGTCAGCTTGAGGTACTTGATTCTCACATCTAAGCAACAATATTTACCTAAAGATGCCCTTGGTGGTTGGACTTCCATGGTATTTCTACAGATTAGTGCCTGCCCAATGTTGACATCACTAACAGAAGGATTTGGCAGCCTCAGTGCACTCAGAGAGCTATTTGTCTTTAATTGTCCAAAGTTGCCATCTCTCCCCTCCAGCATGAACCGGCTTGTCACCCTTCAGAAATTGGTGATTCATAACTGTGATGAGTTAGATTTGATGGAATCAGAGGAAGCAATGGGTGGGCTGAATAGTCTCGAATCAATTGAACTTGCAGGACTTCCCAAGTTTAAGACCTTTCCAGATAGCTTTGCATCAGCTTCTTCCTCTCTTCAATACCTGAAGGTTAGTGACTGCCCACAATTCGAGGAGTTGCCAGATTTCATTAAGAGATTCTCCTCTCTGAAGAAAATTGAGATCCCTAAAAGCCGTGCACCTTCCACTATAACCTGGGCATAG


Protein sequences

Name Description Sequence
hypothetical protein Os12g0477100 [Oryza sativa (japonica cultivar-group)].

MTVLSVLASSILSKVTTFAVEYALDDIKFAWNVKSELEKLKNSLGAICAVLKDAERKQSTHSSLKHWLENLKDVVYDIDDVLDDVGTRVLQQKVRKGEICTYFAQLTIFPFELGRKIRKVRERLNEIAALKRDFELKEEPIDTPSDQFAQRETHSLIGEQNIFGRDKAKNDIVKMISEAAESNSNTLSVLPLIGMGGVGKTALAKLVFNDKSTKDKFDKMLWASVSNAFDLKHIVNIIIQSDSGESNNQLTLEALTKKLHELLRDKRYLLVLDDISNDNVNWEELINLLPSGRSGCMILITTRLTKIASELKTLEPYEVPKLPHEECRKIFVRYAFRGEKAKDRELLKIGESIVQKCDGLPLAARTLGSLLFRKDISMWQEVKENNLLSTGKGKDDILSVLKLSYDALPSDLKTCFSWLSTFPKDYDIFRELIIMYWMAMGLLNPASRTKEAIRVGEKYFNELAGRSLFQDYVFNHDGSISHCKMHSLVHDLAISVSQNEHAIVGCENFTATERVKNLVWDHKDFTTELKFPTQLRRARKARTFACRHNYGTVSKSFLEDLLATFTLLRVLVFSEVEFEELPSSIGNLKHLRYLDLQWNMKIKFLPNSLCKLVNLQTLQLAWCKELEELPKDVKRLVSLRYLILTSKQQYLPKDALGGWTSMVFLQISACPMLTSLTEGFGSLSALRELFVFNCPKLPSLPSSMNRLVTLQKLVIHNCDELDLMESEEAMGGLNSLESIELAGLPKFKTFPDSFASASSSLQYLKVSDCPQFEELPDFIKRFSSLKKIEIPKSRAPSTITWA

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF225
5-790 PTHR23155:SF225,OS12G0477100 PROTEIN

SVLASSILSKVTTFAVEYALDDIKFAWNVKSELEKLKNSLGAICAVLKDAERKQSTHSSLKHWLENLKDVVYDIDDVLDDVGTRVLQQKVRKGEICTYFAQLTIFPFELGRKIRKVRERLNEIAALKRDFELKEEPIDTPSDQFAQRETHSLIGEQNIFGRDKAKNDIVKMISEAAESNSNTLSVLPLIGMGGVGKTALAKLVFNDKSTKDKFDKMLWASVSNAFDLKHIVNIIIQSDSGESNNQLTLEALTKKLHELLRDKRYLLVLDDISNDNVNWEELINLLPSGRSGCMILITTRLTKIASELKTLEPYEVPKLPHEECRKIFVRYAFRGEKAKDRELLKIGESIVQKCDGLPLAARTLGSLLFRKDISMWQEVKENNLLSTGKGKDDILSVLKLSYDALPSDLKTCFSWLSTFPKDYDIFRELIIMYWMAMGLLNPASRTKEAIRVGEKYFNELAGRSLFQDYVFNHDGSISHCKMHSLVHDLAISVSQNEHAIVGCENFTATERVKNLVWDHKDFTTELKFPTQLRRARKARTFACRHNYGTVSKSFLEDLLATFTLLRVLVFSEVEFEELPSSIGNLKHLRYLDLQWNMKIKFLPNSLCKLVNLQTLQLAWCKELEELPKDVKRLVSLRYLILTSKQQYLPKDALGGWTSMVFLQISACPMLTSLTEGFGSLSALRELFVFNCPKLPSLPSSMNRLVTLQKLVIHNCDELDLMESEEAMGGLNSLESIELAGLPKFKTFPDSFASASSSLQYLKVSDCPQFEELPDFIKRFSSLKKIEI

HMMPanther: PTHR23155
5-790 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

SVLASSILSKVTTFAVEYALDDIKFAWNVKSELEKLKNSLGAICAVLKDAERKQSTHSSLKHWLENLKDVVYDIDDVLDDVGTRVLQQKVRKGEICTYFAQLTIFPFELGRKIRKVRERLNEIAALKRDFELKEEPIDTPSDQFAQRETHSLIGEQNIFGRDKAKNDIVKMISEAAESNSNTLSVLPLIGMGGVGKTALAKLVFNDKSTKDKFDKMLWASVSNAFDLKHIVNIIIQSDSGESNNQLTLEALTKKLHELLRDKRYLLVLDDISNDNVNWEELINLLPSGRSGCMILITTRLTKIASELKTLEPYEVPKLPHEECRKIFVRYAFRGEKAKDRELLKIGESIVQKCDGLPLAARTLGSLLFRKDISMWQEVKENNLLSTGKGKDDILSVLKLSYDALPSDLKTCFSWLSTFPKDYDIFRELIIMYWMAMGLLNPASRTKEAIRVGEKYFNELAGRSLFQDYVFNHDGSISHCKMHSLVHDLAISVSQNEHAIVGCENFTATERVKNLVWDHKDFTTELKFPTQLRRARKARTFACRHNYGTVSKSFLEDLLATFTLLRVLVFSEVEFEELPSSIGNLKHLRYLDLQWNMKIKFLPNSLCKLVNLQTLQLAWCKELEELPKDVKRLVSLRYLILTSKQQYLPKDALGGWTSMVFLQISACPMLTSLTEGFGSLSALRELFVFNCPKLPSLPSSMNRLVTLQKLVIHNCDELDLMESEEAMGGLNSLESIELAGLPKFKTFPDSFASASSSLQYLKVSDCPQFEELPDFIKRFSSLKKIEI

superfamily: SSF52540
145-385 SSF52540

SDQFAQRETHSLIGEQNIFGRDKAKNDIVKMISEAAESNSNTLSVLPLIGMGGVGKTALAKLVFNDKSTKDKFDKMLWASVSNAFDLKHIVNIIIQSDSGESNNQLTLEALTKKLHELLRDKRYLLVLDDISNDNVNWEELINLLPSGRSGCMILITTRLTKIASELKTLEPYEVPKLPHEECRKIFVRYAFRGEKAKDRELLKIGESIVQKCDGLPLAARTLGSLLFRKDISMWQEVKEN

Gene3D: G3DSA:3.40.50.300
163-303 G3DSA:3.40.50.300

FGRDKAKNDIVKMISEAAESNSNTLSVLPLIGMGGVGKTALAKLVFNDKSTKDKFDKMLWASVSNAFDLKHIVNIIIQSDSGESNNQLTLEALTKKLHELLRDKRYLLVLDDISNDNVNWEELINLLPSGRSGCMILITTR

HMMPfam: PF00931
IPR002182
176-445 NB-ARC,NBS
NB-ARC

ISEAAESNSNTLSVLPLIGMGGVGKTALAKLVFNDKSTKDKFDKMLWASVSNAFDLKHIVNIIIQSDSGESNNQLTLEALTKKLHELLRDKRYLLVLDDISNDNVNWEELINLLPSGRSGCMILITTRLTKIASELKTLEPYEVPKLPHEECRKIFVRYAFRGEKAKDRELLKIGESIVQKCDGLPLAARTLGSLLFRKDISMWQEVKENNLLSTGKGKDDILSVLKLSYDALPSDLKTCFSWLSTFPKDYDIFRELIIMYWMAMGLLNP

FPrintScan: PR00364
IPR000767
189-204 DISEASERSIST
Disease resistance protein

VLPLIGMGGVGKTALA

FPrintScan: PR00364
IPR000767
262-276 DISEASERSIST
Disease resistance protein

LLRDKRYLLVLDDIS

FPrintScan: PR00364
IPR000767
357-371 DISEASERSIST
Disease resistance protein

CDGLPLAARTLGSLL

Gene3D: G3DSA:3.80.10.10
483-776 G3DSA:3.80.10.10

CKMHSLVHDLAISVSQNEHAIVGCENFTATERVKNLVWDHKDFTTELKFPTQLRRARKARTFACRHNYGTVSKSFLEDLLATFTLLRVLVFSEVEFEELPSSIGNLKHLRYLDLQWNMKIKFLPNSLCKLVNLQTLQLAWCKELEELPKDVKRLVSLRYLILTSKQQYLPKDALGGWTSMVFLQISACPMLTSLTEGFGSLSALRELFVFNCPKLPSLPSSMNRLVTLQKLVIHNCDELDLMESEEAMGGLNSLESIELAGLPKFKTFPDSFASASSSLQYLKVSDCPQFEELP

superfamily: SSF52058
484-792 SSF52058,LRR

KMHSLVHDLAISVSQNEHAIVGCENFTATERVKNLVWDHKDFTTELKFPTQLRRARKARTFACRHNYGTVSKSFLEDLLATFTLLRVLVFSEVEFEELPSSIGNLKHLRYLDLQWNMKIKFLPNSLCKLVNLQTLQLAWCKELEELPKDVKRLVSLRYLILTSKQQYLPKDALGGWTSMVFLQISACPMLTSLTEGFGSLSALRELFVFNCPKLPSLPSSMNRLVTLQKLVIHNCDELDLMESEEAMGGLNSLESIELAGLPKFKTFPDSFASASSSLQYLKVSDCPQFEELPDFIKRFSSLKKIEIPK

HMMPfam: PF00560
IPR001611
590-612 LRR_1
Leucine-rich repeat

HLRYLDLQWNMKIKFLPNSLCKL

FPrintScan: PR00364
IPR000767
610-626 DISEASERSIST
Disease resistance protein

CKLVNLQTLQLAWCKEL

HMMPfam: PF13504
614-630 LRR_7,Leucine rich repeat

NLQTLQLAWCKELEELP


List of References




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox