PRGDB00049858 (Os12g0438300)

From PRG Wiki
Jump to: navigation, search
Os12g0438300
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 115488405 (NM_001073222)
Gene Class NL
Domain Type NBS, LRR
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa (japonica cultivar-group) Os12g0438300 (Os12g0438300) mRNA, complete cds.

DNA Sequence

ATGGCAGAAGCAATCTTCTCGGCAATTGTTGGCGATGTGATCGGCAGAGTGATATCCCTTGTTGTCAGTAATTTCAATGGAGATCACAGCACTGAAGTCAAGTTACAGAGGATATGCCGCATGCTGATCAAGATCCATAGCGTAGTTGAGGAGGCCAAAGGGAGGCAGATCACCAACCATGGCACCCTCGAGTGGCTCTCGGAGCTCATCGATGGCGCATACCAAGGCCGTTACTTGCTCGACACGATCGGATGCGGGGAGCCTGATCTTGATGACAAGAATCGCGATGAGGTAGATCCCAAGCCTTTCTCCTTGTCCAAGTTCAATCCTGCAAAGCGTGTGCGCGTCGCGGCTTTCACCGTGAGGAACATACTGTCTCGCCACGACATCGGTGTTGATGAGATTGATAGGGTGGTTGAGAGCTTGCAGAGCATGTGTGGTGATCTCAAGGAGTTCATGATGCTCCTTCAGGCCTGCCAGCCGATTCATCGGCCTCTAGCTACCAACATCTTCATCGAGGGGCAGATGTTCGGCCGACATGTCAAAAAGGAGATGATCATCAACTTCTTGCTGCATGAGGATGATCTACCAAGAGGAAAACTTGGTGTTCTTCCGATTCTAGGCGATATCGGGGTCGGGAAGACCACCCTAGTACAGCATGCCTGTGATGATGCTAGGGTGCGCAGCCACTTCACAACAATCTTGCTGTTCAATTTCTCACACACCTACAAGATGGAGATGTGTGAACCAAAGCCTGTTCTACGGCCTAAACATGTCATCGGAGATGTTGGAAATTCAGATGATCCACTACATGAACTGGAGCAGAGTTTCTTCAACAAGAGGTTCTTGATTGTTTTCGAGGATGTTGACATACACAAGAAGAACATGCTTGAGGAGCTCCTGAAAAGCCTGAGTTGTGGCAAACAAGGTAGCAAGATCATAGTCACAACCAGCAACAAGCATGTCACTACAATTGGAACAGTGCAGCCTATCAAACTGAAGTTTTTGCCCTGCCCAGAGTACTGGTTCTTCTTCAAAGCGCATGCCTTCGCCGGCACAGATGTCCAGGAGAACCCTAGGCTGGTGGCAGCAGGAAAATCGATCGCCGCGAAGCTGAACGGATCATTCTTCGGCGCAAAGATCATCGGGGCGATTCTGAAAGAAAATCCAGATCCTAAATTCTGGTGTACGGTTCTTCAGAGAGATATTGGGGGGCTGTCATTGTTGGGTGATGGACTTGGCTACATTGCTGATTTAGTGGAAATTTTGCTGCCAAGTCGCCTATCCGTGAAGGAGGTCTTCGTCTCCAAGAACTCATTGTCCTCTGAGACAGAGTTGGCTAGGCTGCAGGGTCTGTGCTTGCCATGTCCTAGCTCTGCCCCTCTAGCCACTCATAGCAGTGAGCTCAGCTTAGCAAAAGCAACCAGCTATGAAAGAGTGTTGCTGTGCAAGGCAGTGTTGCCATTCTACTCCTTGTACTACACTGCTAAGTGTGCTGTGGACTCTGAGAACTGTTACTCAAAGTTTAGTGTTGTTTAG


Protein sequences

Name Description Sequence
hypothetical protein Os12g0438300 [Oryza sativa (japonica cultivar-group)].

MAEAIFSAIVGDVIGRVISLVVSNFNGDHSTEVKLQRICRMLIKIHSVVEEAKGRQITNHGTLEWLSELIDGAYQGRYLLDTIGCGEPDLDDKNRDEVDPKPFSLSKFNPAKRVRVAAFTVRNILSRHDIGVDEIDRVVESLQSMCGDLKEFMMLLQACQPIHRPLATNIFIEGQMFGRHVKKEMIINFLLHEDDLPRGKLGVLPILGDIGVGKTTLVQHACDDARVRSHFTTILLFNFSHTYKMEMCEPKPVLRPKHVIGDVGNSDDPLHELEQSFFNKRFLIVFEDVDIHKKNMLEELLKSLSCGKQGSKIIVTTSNKHVTTIGTVQPIKLKFLPCPEYWFFFKAHAFAGTDVQENPRLVAAGKSIAAKLNGSFFGAKIIGAILKENPDPKFWCTVLQRDIGGLSLLGDGLGYIADLVEILLPSRLSVKEVFVSKNSLSSETELARLQGLCLPCPSSAPLATHSSELSLAKATSYERVLLCKAVLPFYSLYYTAKCAVDSENCYSKFSVV


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF121
6-246 PTHR23155:SF121,SUBFAMILY NOT NAMED

FSAIVGDVIGRVISLVVSNFNGDHSTEVKLQRICRMLIKIHSVVEEAKGRQITNHGTLEWLSELIDGAYQGRYLLDTIGCGEPDLDDKNRDEVDPKPFSLSKFNPAKRVRVAAFTVRNILSRHDIGVDEIDRVVESLQSMCGDLKEFMMLLQACQPIHRPLATNIFIEGQMFGRHVKKEMIINFLLHEDDLPRGKLGVLPILGDIGVGKTTLVQHACDDARVRSHFTTILLFNFSHTYKME

HMMPanther: PTHR23155
6-246 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

FSAIVGDVIGRVISLVVSNFNGDHSTEVKLQRICRMLIKIHSVVEEAKGRQITNHGTLEWLSELIDGAYQGRYLLDTIGCGEPDLDDKNRDEVDPKPFSLSKFNPAKRVRVAAFTVRNILSRHDIGVDEIDRVVESLQSMCGDLKEFMMLLQACQPIHRPLATNIFIEGQMFGRHVKKEMIINFLLHEDDLPRGKLGVLPILGDIGVGKTTLVQHACDDARVRSHFTTILLFNFSHTYKME

superfamily: SSF52540
159-351 SSF52540

CQPIHRPLATNIFIEGQMFGRHVKKEMIINFLLHEDDLPRGKLGVLPILGDIGVGKTTLVQHACDDARVRSHFTTILLFNFSHTYKMEMCEPKPVLRPKHVIGDVGNSDDPLHELEQSFFNKRFLIVFEDVDIHKKNMLEELLKSLSCGKQGSKIIVTTSNKHVTTIGTVQPIKLKFLPCPEYWFFFKAHAFA

Gene3D: G3DSA:3.40.50.300
177-321 G3DSA:3.40.50.300

FGRHVKKEMIINFLLHEDDLPRGKLGVLPILGDIGVGKTTLVQHACDDARVRSHFTTILLFNFSHTYKMEMCEPKPVLRPKHVIGDVGNSDDPLHELEQSFFNKRFLIVFEDVDIHKKNMLEELLKSLSCGKQGSKIIVTTSNKH

HMMPfam: PF00931
IPR002182
183-400 NB-ARC,NBS
NB-ARC

KEMIINFLLHEDDLPRGKLGVLPILGDIGVGKTTLVQHACDDARVRSHFTTILLFNFSHTYKMEMCEPKPVLRPKHVIGDVGNSDDPLHELEQSFFNKRFLIVFEDVDIHKKNMLEELLKSLSCGKQGSKIIVTTSNKHVTTIGTVQPIKLKFLPCPEYWFFFKAHAFAGTDVQENPRLVAAGKSIAAKLNGSFFGAKIIGAILKENPDPKFWCTVLQ


List of References




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox