PRGDB00049860 (Os12g0273300)

From PRG Wiki
Jump to: navigation, search
Os12g0273300
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 115488135 (NM_001073087)
Gene Class NL
Domain Type LRR, NBS, LRR, LRR, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa (japonica cultivar-group) Os12g0273300 (Os12g0273300) mRNA, complete cds.

DNA Sequence

ATGGATGTGCAGGTGAAGGACTGGAGGAACAAGGTCCGGGAACTGAGCTATGATATCGAGGATTGCATCGATTTATTCATGCACAAATTGAATCGCGGGGATGATAAGGTCAACATTGTTCTCAAGATGGCAAAGAAGATTAGAATGTTATGGTCAAGGCATCAGATTGCTAACCAGATCCAAGAACTTAAGGCTCGTGTCAAGGAAGAGAGTGATCGCCGTTTGAGGTACTACTTCAGCGAGTGCAATGCACATGTCGACGGGACTAAAATTGATCCCCGCCTACCGGCGCTTTATGTTGAAGAAGAGAAGCTTGTTGGTATCCATGGCCCTATGGAAGAGATCATTGAATTGTTGATGAAAGAGGATGGTTCGGGGCAAAAACTCAAAGTGGTATCCATTGTGGGTTTTGGCGGACTCGGCAAAACTACTCTGGCTAACCAAGTATACAACAAAATCAAGGATCAATTTGATTGCTCAGCTTTTATATCTGTTTCGCAGAGTCCTAACATAAAGAAAATTTTATTTGATATGCTTAAAGATGTGACCAGCCGAGACAACTCTGATGATGATAAGCAAATTAAAGTTGTTGGGGTCAAAGGAGATAAATCCGATGATGAGAGGCAACTCATTGGTAAGCTCAGAGTATTCCTAGAGAATAAGAGGTACTTCATCATTGTTGATGATATCTGGAGTGCATCTGCATGGGAACATGTGAGGTTAGCTTTGCCTGAGAACAGTCTTTGTAGTAGAATAATTACAACCACACGGAATGTCAATGTGGCAAAATCATGCTGCTCTGGTTTTCAAGGTTCTGTTTACAACATTCAACCTCTAAATGAGCAAGACTCTAAGAAGCTATTTCTGAAAAGGCTTTTCCACTCAGACTCCAATTTTCCTACTCACTTGGAAGAAGTTTCACATGCAATCATTAAAAAGTGCCATGGCTTTCCATTAGCTATTATCTGTTTAGCTAGTCTGCTAGCTAGTAAATCTGATACAAAAGACCAATGGGAGCAAGTGCACAATTCTCTCAGTTCTGCGTTTAGTTCACAAGGGATGAGCGATATACTGCTGCTTAGCTATTATGATCTACCCTATCATCTGAAGACATGCTTGTTGTATCTTAGTGTATTTCCAGAGGATTATAAGATTGATAGAGATGAACTGATATGGAGATGGATAGCTGAAGGTTTCATCACTGAAGTGAAGGGTCAAACATTGGACCAAGTTGGAGGGAGTTACTTTAATGAGCTTATCAACAGAAACATGATTCAACCAATTGACATCAAATATGATGGTACCGCAAATGCTTGTCGAGTACATGATATGGTGCTTAACCTTATCATATCCATTTCATCTGAGGAAAATTTTCTCACCGTAGTTGACGAGCAAGGGTATAAATATTTGGGTAATAAGATTCGACGGCTCTCATTCCAGTCCAACTCTGTTGAGAATGATGTGAATGTAGTTCAAAAGATCATGGACAACTTGTCACAGGTTCGTTCGCTAAGCTTCTTTGAGGTACCAGAGAAAATACCTCCTTTCTTAAAATTCCATTCATTGAGTGTATTGGTTTTAGTGGATTATGATTTTTGTCTTGGTAATGGACACATTAAATACCTTGGAAGTTTTTTCCAATTGAAGTATTTGAGAGTCACTTCTTATGGCATTACCCAGCTCCCAGATCAATTCGGGAACCTCCATTATCTACAAACTCTGGATATACGTGGCAGTGGAATCGAAAAGTTTCCGCCAACCGTGGTCCGTTTGCATAACTTGGCTCGTCTACTTGTTGGCAATAAAGTGCAATTGCCTGATGGTATTGGAGATCTGCAATCCTTACAGGTGCTGTCTTCTGCTCGGTTGTATAAACCCCTAAAACTTGTGGAAGATCTCAGGAGATTGACCAAACTAAGGACGCTTGAGATAGTTCTTCATGGCAGTGATACACTTGGTGCTCATGAGATGGGAAGGTATGAGGAAGCTTTGGAGTCTTCTCTTACTGTGTTGGGCAAACACAAAATTCAGTCACTCGAAATTTCATGTTGTGATTACTTGAGAGATAAATTACTGGATTTGTTGTGCTGCACTGTTCCAAACATTCAGAAGCTTGTAATATCTGGCAATTGCATAAATAGGCCTTCTCAGCAGATGCTATCTCTTGTTAATCTCGCTCACCTAGACATCTATTTCCAGAGGATTAAGCAGGAAGATCTCAGTGTCCTTGGAAGCATATCTACTCTGCTCTACCTCCGGTTGAAACTGCATTTTGTGCCTGACGAAAGGCTCTGTATCAGCAGCCAACAATTCCAGAGCCTGATGGAGTTCAGATTCATATATTATGAGGGGGGTGGCTTGAGGATGTTATTTCAACAGGAAGCAATGGCAAAGCTTCGACGGTTACAGATTCGGTTTAGAGCAGAGGAAATGGAGTCTAATGCAGGTTTCGAGTTCAGTTTTCATCACCTCTCAAGCCTGGAGGACCTTCATGCCACGATTAGTTGTTATAGAGCCACTAGAAGTAGCGTGGAGGCTGCAGAAGCTGCCATCAGGAATGCAGCTAGTATCCATCCTGGACATCTAAAAGTTTCAATCATAAGAGAGTGGGAAAGCCGCATGGCGGGGCTCAGAGAGAGATGA


Protein sequences

Name Description Sequence
hypothetical protein Os12g0273300 [Oryza sativa (japonica cultivar-group)].

MDVQVKDWRNKVRELSYDIEDCIDLFMHKLNRGDDKVNIVLKMAKKIRMLWSRHQIANQIQELKARVKEESDRRLRYYFSECNAHVDGTKIDPRLPALYVEEEKLVGIHGPMEEIIELLMKEDGSGQKLKVVSIVGFGGLGKTTLANQVYNKIKDQFDCSAFISVSQSPNIKKILFDMLKDVTSRDNSDDDKQIKVVGVKGDKSDDERQLIGKLRVFLENKRYFIIVDDIWSASAWEHVRLALPENSLCSRIITTTRNVNVAKSCCSGFQGSVYNIQPLNEQDSKKLFLKRLFHSDSNFPTHLEEVSHAIIKKCHGFPLAIICLASLLASKSDTKDQWEQVHNSLSSAFSSQGMSDILLLSYYDLPYHLKTCLLYLSVFPEDYKIDRDELIWRWIAEGFITEVKGQTLDQVGGSYFNELINRNMIQPIDIKYDGTANACRVHDMVLNLIISISSEENFLTVVDEQGYKYLGNKIRRLSFQSNSVENDVNVVQKIMDNLSQVRSLSFFEVPEKIPPFLKFHSLSVLVLVDYDFCLGNGHIKYLGSFFQLKYLRVTSYGITQLPDQFGNLHYLQTLDIRGSGIEKFPPTVVRLHNLARLLVGNKVQLPDGIGDLQSLQVLSSARLYKPLKLVEDLRRLTKLRTLEIVLHGSDTLGAHEMGRYEEALESSLTVLGKHKIQSLEISCCDYLRDKLLDLLCCTVPNIQKLVISGNCINRPSQQMLSLVNLAHLDIYFQRIKQEDLSVLGSISTLLYLRLKLHFVPDERLCISSQQFQSLMEFRFIYYEGGGLRMLFQQEAMAKLRRLQIRFRAEEMESNAGFEFSFHHLSSLEDLHATISCYRATRSSVEAAEAAIRNAASIHPGHLKVSIIREWESRMAGLRER

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
1-879 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

MDVQVKDWRNKVRELSYDIEDCIDLFMHKLNRGDDKVNIVLKMAKKIRMLWSRHQIANQIQELKARVKEESDRRLRYYFSECNAHVDGTKIDPRLPALYVEEEKLVGIHGPMEEIIELLMKEDGSGQKLKVVSIVGFGGLGKTTLANQVYNKIKDQFDCSAFISVSQSPNIKKILFDMLKDVTSRDNSDDDKQIKVVGVKGDKSDDERQLIGKLRVFLENKRYFIIVDDIWSASAWEHVRLALPENSLCSRIITTTRNVNVAKSCCSGFQGSVYNIQPLNEQDSKKLFLKRLFHSDSNFPTHLEEVSHAIIKKCHGFPLAIICLASLLASKSDTKDQWEQVHNSLSSAFSSQGMSDILLLSYYDLPYHLKTCLLYLSVFPEDYKIDRDELIWRWIAEGFITEVKGQTLDQVGGSYFNELINRNMIQPIDIKYDGTANACRVHDMVLNLIISISSEENFLTVVDEQGYKYLGNKIRRLSFQSNSVENDVNVVQKIMDNLSQVRSLSFFEVPEKIPPFLKFHSLSVLVLVDYDFCLGNGHIKYLGSFFQLKYLRVTSYGITQLPDQFGNLHYLQTLDIRGSGIEKFPPTVVRLHNLARLLVGNKVQLPDGIGDLQSLQVLSSARLYKPLKLVEDLRRLTKLRTLEIVLHGSDTLGAHEMGRYEEALESSLTVLGKHKIQSLEISCCDYLRDKLLDLLCCTVPNIQKLVISGNCINRPSQQMLSLVNLAHLDIYFQRIKQEDLSVLGSISTLLYLRLKLHFVPDERLCISSQQFQSLMEFRFIYYEGGGLRMLFQQEAMAKLRRLQIRFRAEEMESNAGFEFSFHHLSSLEDLHATISCYRATRSSVEAAEAAIRNAASIHPGHLKVSIIREWESRMAGLRE

HMMPanther: PTHR23155:SF224
1-879 PTHR23155:SF224,OS12G0273300 PROTEIN

MDVQVKDWRNKVRELSYDIEDCIDLFMHKLNRGDDKVNIVLKMAKKIRMLWSRHQIANQIQELKARVKEESDRRLRYYFSECNAHVDGTKIDPRLPALYVEEEKLVGIHGPMEEIIELLMKEDGSGQKLKVVSIVGFGGLGKTTLANQVYNKIKDQFDCSAFISVSQSPNIKKILFDMLKDVTSRDNSDDDKQIKVVGVKGDKSDDERQLIGKLRVFLENKRYFIIVDDIWSASAWEHVRLALPENSLCSRIITTTRNVNVAKSCCSGFQGSVYNIQPLNEQDSKKLFLKRLFHSDSNFPTHLEEVSHAIIKKCHGFPLAIICLASLLASKSDTKDQWEQVHNSLSSAFSSQGMSDILLLSYYDLPYHLKTCLLYLSVFPEDYKIDRDELIWRWIAEGFITEVKGQTLDQVGGSYFNELINRNMIQPIDIKYDGTANACRVHDMVLNLIISISSEENFLTVVDEQGYKYLGNKIRRLSFQSNSVENDVNVVQKIMDNLSQVRSLSFFEVPEKIPPFLKFHSLSVLVLVDYDFCLGNGHIKYLGSFFQLKYLRVTSYGITQLPDQFGNLHYLQTLDIRGSGIEKFPPTVVRLHNLARLLVGNKVQLPDGIGDLQSLQVLSSARLYKPLKLVEDLRRLTKLRTLEIVLHGSDTLGAHEMGRYEEALESSLTVLGKHKIQSLEISCCDYLRDKLLDLLCCTVPNIQKLVISGNCINRPSQQMLSLVNLAHLDIYFQRIKQEDLSVLGSISTLLYLRLKLHFVPDERLCISSQQFQSLMEFRFIYYEGGGLRMLFQQEAMAKLRRLQIRFRAEEMESNAGFEFSFHHLSSLEDLHATISCYRATRSSVEAAEAAIRNAASIHPGHLKVSIIREWESRMAGLRE

superfamily: SSF52540
88-352 SSF52540

GTKIDPRLPALYVEEEKLVGIHGPMEEIIELLMKEDGSGQKLKVVSIVGFGGLGKTTLANQVYNKIKDQFDCSAFISVSQSPNIKKILFDMLKDVTSRDNSDDDKQIKVVGVKGDKSDDERQLIGKLRVFLENKRYFIIVDDIWSASAWEHVRLALPENSLCSRIITTTRNVNVAKSCCSGFQGSVYNIQPLNEQDSKKLFLKRLFHSDSNFPTHLEEVSHAIIKKCHGFPLAIICLASLLASKSDTKDQWEQVHNSLSSAFSSQ

HMMPfam: PF00931
IPR002182
111-403 NB-ARC,NBS
NB-ARC

PMEEIIELLMKEDGSGQKLKVVSIVGFGGLGKTTLANQVYNKIKDQFDCSAFISVSQSPNIKKILFDMLKDVTSRDNSDDDKQIKVVGVKGDKSDDERQLIGKLRVFLENKRYFIIVDDIWSASAWEHVRLALPENSLCSRIITTTRNVNVAKSCCSGFQGSVYNIQPLNEQDSKKLFLKRLFHSDSNFPTHLEEVSHAIIKKCHGFPLAIICLASLLASKSDTKDQWEQVHNSLSSAFSSQGMSDILLLSYYDLPYHLKTCLLYLSVFPEDYKIDRDELIWRWIAEGFITEV

Gene3D: G3DSA:3.40.50.300
112-237 G3DSA:3.40.50.300

MEEIIELLMKEDGSGQKLKVVSIVGFGGLGKTTLANQVYNKIKDQFDCSAFISVSQSPNIKKILFDMLKDVTSRDNSDDDKQIKVVGVKGDKSDDERQLIGKLRVFLENKRYFIIVDDIWSASAWE

FPrintScan: PR00364
IPR000767
131-146 DISEASERSIST
Disease resistance protein

VVSIVGFGGLGKTTLA

FPrintScan: PR00364
IPR000767
217-231 DISEASERSIST
Disease resistance protein

FLENKRYFIIVDDIW

FPrintScan: PR00364
IPR000767
314-328 DISEASERSIST
Disease resistance protein

CHGFPLAIICLASLL

superfamily: SSF52058
440-831 SSF52058,LRR

RVHDMVLNLIISISSEENFLTVVDEQGYKYLGNKIRRLSFQSNSVENDVNVVQKIMDNLSQVRSLSFFEVPEKIPPFLKFHSLSVLVLVDYDFCLGNGHIKYLGSFFQLKYLRVTSYGITQLPDQFGNLHYLQTLDIRGSGIEKFPPTVVRLHNLARLLVGNKVQLPDGIGDLQSLQVLSSARLYKPLKLVEDLRRLTKLRTLEIVLHGSDTLGAHEMGRYEEALESSLTVLGKHKIQSLEISCCDYLRDKLLDLLCCTVPNIQKLVISGNCINRPSQQMLSLVNLAHLDIYFQRIKQEDLSVLGSISTLLYLRLKLHFVPDERLCISSQQFQSLMEFRFIYYEGGGLRMLFQQEAMAKLRRLQIRFRAEEMESNAGFEFSFHHLSSLEDLH

Gene3D: G3DSA:3.80.10.10
457-643 G3DSA:3.80.10.10

NFLTVVDEQGYKYLGNKIRRLSFQSNSVENDVNVVQKIMDNLSQVRSLSFFEVPEKIPPFLKFHSLSVLVLVDYDFCLGNGHIKYLGSFFQLKYLRVTSYGITQLPDQFGNLHYLQTLDIRGSGIEKFPPTVVRLHNLARLLVGNKVQLPDGIGDLQSLQVLSSARLYKPLKLVEDLRRLTKLRTLE

FPrintScan: PR00364
IPR000767
566-582 DISEASERSIST
Disease resistance protein

GNLHYLQTLDIRGSGIE

Gene3D: G3DSA:3.80.10.10
675-768 G3DSA:3.80.10.10

KIQSLEISCCDYLRDKLLDLLCCTVPNIQKLVISGNCINRPSQQMLSLVNLAHLDIYFQRIKQEDLSVLGSISTLLYLRLKLHFVPDERLCISS


List of References




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox