PRGDB00049862 (Os12g0270300)

From PRG Wiki
Jump to: navigation, search
Os12g0270300
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 115488121 (NM_001073080)
Gene Class NL
Domain Type NBS, LRR, LRR, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa (japonica cultivar-group) Os12g0270300 (Os12g0270300) mRNA, complete cds.

DNA Sequence

ATGGCAGGAGCATTTGTTAGTGCTTCAGTAGGGGTGCTGAATCCTCTTCTAACCAAGCTTTCCGCCTTGGTCGAGGGAGAGTACAAGCTGCTCAAAAGTGTGAAGAAGGATATCATCTTTTTGAGGAATGAGCTCAGCAGCATCAGTGTCTTGCTTGAGCATCTGTCGACCAAGGAGGACAAGCTTGATGGGCCGACCAAGGAGTGGAGGAACAACATGCTCGAGCTAGCTTATGATATTGAGGATTGCATCGACCTCTTCATCCACAAGTTGAGTTGTGGCGATGCGAATGCCAACTTTGTTCAGAAGATAGGAAGCAAGATAAAGAAGTTATGGGGCAAACACCAGATCACAGAGTGTATCCAAGAACTGAAGAATCGGGTTATGGAGGAGGATCAACGTCGCAAGAGGAATCAGATCGATGATTTCATCTCCGAGCCAAGTGTGGTGGAAATTGATCCCCGTCTACCGGCATTGTATGAGGAGGTGGAGAGGCTCGTGGGGATTGATGGTCCAAGGGAGAAGATCATTAAGTGGATCATGACCAAAGGCAAGCCATTAGAGCAACGTAAAGTGGTTTCTATTGTTGGTTTGGGTGGTCTTGGAAAGACAACTCTAGCTAATGAAGTGTACAAGACAATACAAGGGGATTTTAAGTGTATAACTTTTGTGTCTATTTCACGTACCCCTAATATAAGGAAGATCTTGGTTGATATGCTTAAAGGACTCGGGAGCAATGGAGATGTATCGGAAGATGAGCAGAACCTCATCAGTCATCTTCGAGGATTCTTGAAAGATAAAAGGTACCTCATTGTTTTTGATGACATTTGGGACATAGGTGCGTGGAAGGTGGTCAATTGTGCTTTCCCAGAGAATAATTTGGGCAGTATAATCATAACAACAACAAGAAACACTGCCGTAGCTGAAGCATGCAGCCGTACCACATCTGAAGGCTATCTTCACAGCATGCAGCCACTAGAAGAGCAAGATTCACAGAGATTATTTTACCGGAGAGCTTTTAATTCTGAGAGTTGCTGCCCGCCTCACCTGGAAGACATCTCTCATGCCATCATATCGAAATGTCGTAGTTTACCATTAGCTATAATCTCCATAGCTAGCTTGCTATCAATCAAACCTGATACAGAGGACCAGTGGATGCAAGTGCACAATTCTATTGGTGTTACACTAAACTCAGACGTCGAAGTGAGAAAAATTTTGATGCTCAGTTATTATGATCTTCCTTATCCCCTGAAAAATTGTCTGTTGTATCTCAGCATGTATCCAGAGGATTATGTAATTGATAGACAAGAACTTATATGGAGATGGATAGCTGAAGGATTCATCATTGAAGCGAAGGGAAAAACACGGGAGCAAGTAGGAGAGAACTACTTCAATGAGCTTATAAATAGAAGCTTGATCCAACCAGTTTATATCCAATATGATGGTAGGGCCAGTTGCTGCCGAGTCCACGATATTGTGCTTGATCTTATCATTAGCCTATCAACTGGACAGAATTTCGTCACAATAGTGCATGAACAACAGCATTGGAGTTCTTTCAAGAAGATTCGGAGGACCTGGTTCCCATCCAATGGCACAGATAATAGAATAGTCAAGGAGATTACGAACAACTGCTCACATGTTCGTTCGCTGTTCTTTGACAGTCCTAAACCGGAGCAAATACCACAATTTAAGAAATGCCATGCTCTGCGGGTATTGGTTCTGGATGGGTGCATGAGCCTGGAGAGCCAGCATATTAACAGCCTAACATACCTTTTCCAGTTGAAGTATCTGAAGCTCAATGTTGCAAATGTTACCGAGATGCCCAAGGATATTGGACGGCTGCAGCAACTAGAAACACTAATTATTCGTGGAGGAGGACATGTCAACGAAATAAACATTCCGTCAAGTGTTTGTAGACTGCAAAAACTAGAGCGCCTAATTGTTGATTACCCAATGAGATTGCCAGATGAAATTGGATTTTTGCAAGCTTTGGAGATGCTATCTCTTTTTTACAACATAGAGTACAGCATAAAATGTTTACAAGAGCTCCGTCGGCTGACCAGACTAAGGTATCTGCGCATAAGGACGCCTTTTGGAGGTGATGTAGCAAGGTTCGAGAGGTACAAGGACGCCTTTTACATGACTCTCGATGAGTTAGGTAAAAATAGCCTTCAATCATTACATGTACATGTTACAACCAAGTTTTCAGATACATTGATGGATTCATGTTGTAGTAGTGCTCCCGGTCTCAGAGAGCTTTCTACTTCTGGCGTTGGAATATCAAAACTTTCGGAGCAGATGATTTCCCTTTCTAATCTTGCCTATCTTGTGATCTTCTATAATACTAGAAGCAATGATCAGAAAGATATCAACCTCCTTGGGTGTATACCCAAGCTTCTCTATCTTAAAGTAATATTCGCCCAAGGCTGGGAGGATGGACTCACTGTAGGCTGTGGTGGATTTCCCTGTCTAAAGGAGTTGATGTTCAGGCATAGTCGCCTGCATTGGTTGTTGTTTGAACCTGGCGCTATGCCAAAACTCCAAAGGCTTTCTATTGAGTTGTTTGCACAAAAAGCAGCATCCAAACTTGGGTTTGAGCAGAGCTTTGTGCACCTTTCCAGCCTCCAGCATCTAATCGTCGTTCTCGATTGTTCTGATGCCCACTACAAGGGACGTGAAAGCTTTGGAAGATGCCATTAG


Protein sequences

Name Description Sequence
hypothetical protein Os12g0270300 [Oryza sativa (japonica cultivar-group)].

MAGAFVSASVGVLNPLLTKLSALVEGEYKLLKSVKKDIIFLRNELSSISVLLEHLSTKEDKLDGPTKEWRNNMLELAYDIEDCIDLFIHKLSCGDANANFVQKIGSKIKKLWGKHQITECIQELKNRVMEEDQRRKRNQIDDFISEPSVVEIDPRLPALYEEVERLVGIDGPREKIIKWIMTKGKPLEQRKVVSIVGLGGLGKTTLANEVYKTIQGDFKCITFVSISRTPNIRKILVDMLKGLGSNGDVSEDEQNLISHLRGFLKDKRYLIVFDDIWDIGAWKVVNCAFPENNLGSIIITTTRNTAVAEACSRTTSEGYLHSMQPLEEQDSQRLFYRRAFNSESCCPPHLEDISHAIISKCRSLPLAIISIASLLSIKPDTEDQWMQVHNSIGVTLNSDVEVRKILMLSYYDLPYPLKNCLLYLSMYPEDYVIDRQELIWRWIAEGFIIEAKGKTREQVGENYFNELINRSLIQPVYIQYDGRASCCRVHDIVLDLIISLSTGQNFVTIVHEQQHWSSFKKIRRTWFPSNGTDNRIVKEITNNCSHVRSLFFDSPKPEQIPQFKKCHALRVLVLDGCMSLESQHINSLTYLFQLKYLKLNVANVTEMPKDIGRLQQLETLIIRGGGHVNEINIPSSVCRLQKLERLIVDYPMRLPDEIGFLQALEMLSLFYNIEYSIKCLQELRRLTRLRYLRIRTPFGGDVARFERYKDAFYMTLDELGKNSLQSLHVHVTTKFSDTLMDSCCSSAPGLRELSTSGVGISKLSEQMISLSNLAYLVIFYNTRSNDQKDINLLGCIPKLLYLKVIFAQGWEDGLTVGCGGFPCLKELMFRHSRLHWLLFEPGAMPKLQRLSIELFAQKAASKLGFEQSFVHLSSLQHLIVVLDCSDAHYKGRESFGRCH

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
9-853 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

SVGVLNPLLTKLSALVEGEYKLLKSVKKDIIFLRNELSSISVLLEHLSTKEDKLDGPTKEWRNNMLELAYDIEDCIDLFIHKLSCGDANANFVQKIGSKIKKLWGKHQITECIQELKNRVMEEDQRRKRNQIDDFISEPSVVEIDPRLPALYEEVERLVGIDGPREKIIKWIMTKGKPLEQRKVVSIVGLGGLGKTTLANEVYKTIQGDFKCITFVSISRTPNIRKILVDMLKGLGSNGDVSEDEQNLISHLRGFLKDKRYLIVFDDIWDIGAWKVVNCAFPENNLGSIIITTTRNTAVAEACSRTTSEGYLHSMQPLEEQDSQRLFYRRAFNSESCCPPHLEDISHAIISKCRSLPLAIISIASLLSIKPDTEDQWMQVHNSIGVTLNSDVEVRKILMLSYYDLPYPLKNCLLYLSMYPEDYVIDRQELIWRWIAEGFIIEAKGKTREQVGENYFNELINRSLIQPVYIQYDGRASCCRVHDIVLDLIISLSTGQNFVTIVHEQQHWSSFKKIRRTWFPSNGTDNRIVKEITNNCSHVRSLFFDSPKPEQIPQFKKCHALRVLVLDGCMSLESQHINSLTYLFQLKYLKLNVANVTEMPKDIGRLQQLETLIIRGGGHVNEINIPSSVCRLQKLERLIVDYPMRLPDEIGFLQALEMLSLFYNIEYSIKCLQELRRLTRLRYLRIRTPFGGDVARFERYKDAFYMTLDELGKNSLQSLHVHVTTKFSDTLMDSCCSSAPGLRELSTSGVGISKLSEQMISLSNLAYLVIFYNTRSNDQKDINLLGCIPKLLYLKVIFAQGWEDGLTVGCGGFPCLKELMFRHSRLHWLLFEPGAMPKLQRLSIE

HMMPanther: PTHR23155:SF223
9-853 PTHR23155:SF223,OS12G0270300 PROTEIN

SVGVLNPLLTKLSALVEGEYKLLKSVKKDIIFLRNELSSISVLLEHLSTKEDKLDGPTKEWRNNMLELAYDIEDCIDLFIHKLSCGDANANFVQKIGSKIKKLWGKHQITECIQELKNRVMEEDQRRKRNQIDDFISEPSVVEIDPRLPALYEEVERLVGIDGPREKIIKWIMTKGKPLEQRKVVSIVGLGGLGKTTLANEVYKTIQGDFKCITFVSISRTPNIRKILVDMLKGLGSNGDVSEDEQNLISHLRGFLKDKRYLIVFDDIWDIGAWKVVNCAFPENNLGSIIITTTRNTAVAEACSRTTSEGYLHSMQPLEEQDSQRLFYRRAFNSESCCPPHLEDISHAIISKCRSLPLAIISIASLLSIKPDTEDQWMQVHNSIGVTLNSDVEVRKILMLSYYDLPYPLKNCLLYLSMYPEDYVIDRQELIWRWIAEGFIIEAKGKTREQVGENYFNELINRSLIQPVYIQYDGRASCCRVHDIVLDLIISLSTGQNFVTIVHEQQHWSSFKKIRRTWFPSNGTDNRIVKEITNNCSHVRSLFFDSPKPEQIPQFKKCHALRVLVLDGCMSLESQHINSLTYLFQLKYLKLNVANVTEMPKDIGRLQQLETLIIRGGGHVNEINIPSSVCRLQKLERLIVDYPMRLPDEIGFLQALEMLSLFYNIEYSIKCLQELRRLTRLRYLRIRTPFGGDVARFERYKDAFYMTLDELGKNSLQSLHVHVTTKFSDTLMDSCCSSAPGLRELSTSGVGISKLSEQMISLSNLAYLVIFYNTRSNDQKDINLLGCIPKLLYLKVIFAQGWEDGLTVGCGGFPCLKELMFRHSRLHWLLFEPGAMPKLQRLSIE

superfamily: SSF52540
149-400 SSF52540

VVEIDPRLPALYEEVERLVGIDGPREKIIKWIMTKGKPLEQRKVVSIVGLGGLGKTTLANEVYKTIQGDFKCITFVSISRTPNIRKILVDMLKGLGSNGDVSEDEQNLISHLRGFLKDKRYLIVFDDIWDIGAWKVVNCAFPENNLGSIIITTTRNTAVAEACSRTTSEGYLHSMQPLEEQDSQRLFYRRAFNSESCCPPHLEDISHAIISKCRSLPLAIISIASLLSIKPDTEDQWMQVHNSIGVTLNSDV

Gene3D: G3DSA:3.40.50.300
163-332 G3DSA:3.40.50.300

VERLVGIDGPREKIIKWIMTKGKPLEQRKVVSIVGLGGLGKTTLANEVYKTIQGDFKCITFVSISRTPNIRKILVDMLKGLGSNGDVSEDEQNLISHLRGFLKDKRYLIVFDDIWDIGAWKVVNCAFPENNLGSIIITTTRNTAVAEACSRTTSEGYLHSMQPLEEQDSQ

HMMPfam: PF00931
IPR002182
174-451 NB-ARC,NBS
NB-ARC

EKIIKWIMTKGKPLEQRKVVSIVGLGGLGKTTLANEVYKTIQGDFKCITFVSISRTPNIRKILVDMLKGLGSNGDVSEDEQNLISHLRGFLKDKRYLIVFDDIWDIGAWKVVNCAFPENNLGSIIITTTRNTAVAEACSRTTSEGYLHSMQPLEEQDSQRLFYRRAFNSESCCPPHLEDISHAIISKCRSLPLAIISIASLLSIKPDTEDQWMQVHNSIGVTLNSDVEVRKILMLSYYDLPYPLKNCLLYLSMYPEDYVIDRQELIWRWIAEGFIIEA

FPrintScan: PR00364
IPR000767
192-207 DISEASERSIST
Disease resistance protein

VVSIVGLGGLGKTTLA

FPrintScan: PR00364
IPR000767
263-277 DISEASERSIST
Disease resistance protein

FLKDKRYLIVFDDIW

FPrintScan: PR00364
IPR000767
361-375 DISEASERSIST
Disease resistance protein

CRSLPLAIISIASLL

Gene3D: G3DSA:3.80.10.10
486-695 G3DSA:3.80.10.10

CCRVHDIVLDLIISLSTGQNFVTIVHEQQHWSSFKKIRRTWFPSNGTDNRIVKEITNNCSHVRSLFFDSPKPEQIPQFKKCHALRVLVLDGCMSLESQHINSLTYLFQLKYLKLNVANVTEMPKDIGRLQQLETLIIRGGGHVNEINIPSSVCRLQKLERLIVDYPMRLPDEIGFLQALEMLSLFYNIEYSIKCLQELRRLTRLRYLRIR

superfamily: SSF52058
488-880 SSF52058,LRR

RVHDIVLDLIISLSTGQNFVTIVHEQQHWSSFKKIRRTWFPSNGTDNRIVKEITNNCSHVRSLFFDSPKPEQIPQFKKCHALRVLVLDGCMSLESQHINSLTYLFQLKYLKLNVANVTEMPKDIGRLQQLETLIIRGGGHVNEINIPSSVCRLQKLERLIVDYPMRLPDEIGFLQALEMLSLFYNIEYSIKCLQELRRLTRLRYLRIRTPFGGDVARFERYKDAFYMTLDELGKNSLQSLHVHVTTKFSDTLMDSCCSSAPGLRELSTSGVGISKLSEQMISLSNLAYLVIFYNTRSNDQKDINLLGCIPKLLYLKVIFAQGWEDGLTVGCGGFPCLKELMFRHSRLHWLLFEPGAMPKLQRLSIELFAQKAASKLGFEQSFVHLSSLQHLIV

FPrintScan: PR00364
IPR000767
564-580 DISEASERSIST
Disease resistance protein

KKCHALRVLVLDGCMSL

Gene3D: G3DSA:3.80.10.10
723-879 G3DSA:3.80.10.10

SLQSLHVHVTTKFSDTLMDSCCSSAPGLRELSTSGVGISKLSEQMISLSNLAYLVIFYNTRSNDQKDINLLGCIPKLLYLKVIFAQGWEDGLTVGCGGFPCLKELMFRHSRLHWLLFEPGAMPKLQRLSIELFAQKAASKLGFEQSFVHLSSLQHLI


List of References




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox