PRGDB00049863 (Os12g0246700)

From PRG Wiki
Jump to: navigation, search
Os12g0246700
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 115488013 (NM_001073026)
Gene Class NL
Domain Type LRR, NBS, LRR, LRR, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa (japonica cultivar-group) Os12g0246700 (Os12g0246700) mRNA, complete cds.

DNA Sequence

ATGGCAGAGTCTGTGGTGTTTGGAATCCTATGCAAAATTGGATCAATATTGGGGTCACATCTGACGCAGGCATTAGTTTCACATCTGGGGAAGGAGGTATCAGTTTTAATTGAGGTTGAAAGCATTGTAAAGCAAATTAGAAGTGAGTTTAGGTTGATGCAATCTTTCCTGCAAGATGGCCAAGAAAAAGAAAGCTCCAGCAGGCAGGCTGAAACCTTTCTGCAGGAAGTTCAGCAGATAGCATTTGAAGTTGAAGACATCCTGGATGAATTTGTCTATTATTTTGGCAGAAAAGAAACCCCATCTGTGGAATTGTTGAAGAACTTCTTCAGAAAATCTGAAAGTGTGATGCCATTGCGCAGAATAGCAGCAGAACTCAAAGAAGTGCAGAATCGTCTCCAAAATATTCGAAACTTGAAACTTCAGTACAATATTGACTTATCTGAAGAAAGTGCCAGCTCCATCAGGTATGAAGATAGCAAAGGTCACACACTCCACCACATAATGCATAATAAGAAACTTGTCGGTTTTGTAAATGAGCGACAGAAGCTGCAAGAGTTGCTAATGGCAAATGAAAGATCATGCTCAATAATTTCCATATGGGGTATGGGAGGTTCCGGTAAAACTACTCTTGTCAAAACTGTTTCCGAAAGCAAAGCTAGCAAGAACCGTTTTGATTGCCAGATCTGGGTTACCGTGTCTCAAACATATGACATTACTGAAATAATGAGGAAGATTATACAGTGTGCATTGAAGGATACATGCTCAGCTGACTTAGGAAGCATGAGTAGTGAAGGCGTAGTGCTGATGCTCCAGGAGACTTTGCAGGGAAGGACATACATGATGGTCTTGGATGATGTGTGGGATACAAATGTTTGGTTCAGCTTGGAAGGCTTTCTAGATGAAAGCAGCATCAGAAGTAAGGTGGTAATTACTACTCGCATAAATGATGTTGCTTCTTTGGCAGAAGACAAGCGCCGTCTTCAACTACGAGGATTAGATGAGGCAGAGTCTTGGGACCTCTTTTGCATGTGGGCTTTCCGGCACGGTGAAGATCAAACATGTCCTCCTGCAATGGACCGAGTAGCAAGACAGATTGTTGGCAGGTGTGAAGGTCTACCGTTGGCTATAACGGCAGTAGGCAACTTGCTATCCTTCAAACGGCTGGATTTGATGGAGTGGGAGAAATTCTATAATCAACTGAACTGGGAGTTGCACAATCGCTTGGATAACCAAGGACTCAGCATGGTGACTCGACTCCTTGGTTTAAGCTACAAGCATCTACCGGTCCACTTGAAGAACTGTTTCCTTTTATGCAGTATCTTCCCAGAGGACTATATGATACGCGGGAAGCGGCTATGTAAACTATTAGTAGTAGAAGGTCTTGTTGAACCAAGAAAAAACATGACACTGGAGGAGATTGCAATGGAGTACATAGAAAAGCTAGTAGATCGCTGCCTGCTTCAAGTTGCTCGGAGAAATAAGCTTGGAAGAGTATGGGAACTCCAGATGCATGACATTATCAGGGAGCTGGCAATTTCAATATCCGAAAAGGAAGGATTCTGCATGATACATAATAAAGCTCAGAGATCGGTGGTTGAGTGCGAGCCTCGTCGGTTATCAATTCATGAGAATTCAGTCAGAGTCCAGCTAAGTATAAATGCTTCACGTGTTCGTTCTTTCTATCAATTTGATATCGATTGTTCCTCCGTGTCAAAAGTGCAATGGGTATCAAGGACTGCTAGGTACCTGAAGGTTCTGGAACTAGGTAGTGTTCCAATCAGAAAACTGCCGAGAGACATTGGGAACTTGTTCAATTTACATTATTTAGGATTAAGACGAACCAAGATCAAGCAACTTCCTGAATCGATTGACAGGCTCCAAAATCTCCGAACTTTGGACATCTTCCTTACTGAAATAGCAAGTCTTCCACGTGGCGTAACCAGGCTAAGGATGCTACGCCATCTGATTGCTGGAAAGGCTGTTGCTTCTTATTTTGGCCTCGAAGATGTCTTCACAGGTGTCAAAGTCCCCAATGGATTATGGCGATCACTGGATCTAAATGTCCTCACAGGCATTTCTGCAAGCAGCAATTTGGTGGAACAATTGGCCAGCTTTACACAGCTGAGATCATTGAAGTTGACAGACGTAAAAAATATCCACTATACAAAGCTATTTGCATCCATCAGAAAGATGCAGCTTCTAAAGAACCTTCTTATTGGAACTGCCAATAGTGATGAGTATGTCAGCTTAGAAGCCCTAGATCCTGCACCTCAGAACCTTGAAATACTCTTTGTGAAAGGTAGACTCCATGATAGGGTTATAGGCTCTGACCTATTTGAGGCAAATAGGCTAACCCTCATGGAGTTGACTCTTGAAAATAGCAGGCTGAGCATAGATCCACTTCCATCACTATCTAATTTCTGTAACCTGACCCTTCTTGGTCTGTTCAACCATTATATTGGAGAAACCTTGCTCTTTCAGGCAGAGTGGTTTCCTAAGCTTCATACACTTACTTTGGCTGAGCTGCAAAATGTCAGTTCAATAGTGATTGAAAAGCATAGCATGCCAAATCTCTATAACTTTGCTCTCATCTGCTTGACAAATTTAGAGGATTTGCCTGAGGGCATGGAATTCCTTGGGTCTGTTGAAGAGCTCAGTTTGGTGGGCATGCACCAAAAATTCATGGAACATGTACAAGGTTCCTCAAATGTAAAAGTCAAACACATTCCTGTAGTTGACTACTTTGATCAAACCAAAGGGAGGTGGGATCGACTTTCTCCACTTTATTTCGAAGACGAAGGCACTAAGAATTGA


Protein sequences

Name Description Sequence
hypothetical protein Os12g0246700 [Oryza sativa (japonica cultivar-group)].

MAESVVFGILCKIGSILGSHLTQALVSHLGKEVSVLIEVESIVKQIRSEFRLMQSFLQDGQEKESSSRQAETFLQEVQQIAFEVEDILDEFVYYFGRKETPSVELLKNFFRKSESVMPLRRIAAELKEVQNRLQNIRNLKLQYNIDLSEESASSIRYEDSKGHTLHHIMHNKKLVGFVNERQKLQELLMANERSCSIISIWGMGGSGKTTLVKTVSESKASKNRFDCQIWVTVSQTYDITEIMRKIIQCALKDTCSADLGSMSSEGVVLMLQETLQGRTYMMVLDDVWDTNVWFSLEGFLDESSIRSKVVITTRINDVASLAEDKRRLQLRGLDEAESWDLFCMWAFRHGEDQTCPPAMDRVARQIVGRCEGLPLAITAVGNLLSFKRLDLMEWEKFYNQLNWELHNRLDNQGLSMVTRLLGLSYKHLPVHLKNCFLLCSIFPEDYMIRGKRLCKLLVVEGLVEPRKNMTLEEIAMEYIEKLVDRCLLQVARRNKLGRVWELQMHDIIRELAISISEKEGFCMIHNKAQRSVVECEPRRLSIHENSVRVQLSINASRVRSFYQFDIDCSSVSKVQWVSRTARYLKVLELGSVPIRKLPRDIGNLFNLHYLGLRRTKIKQLPESIDRLQNLRTLDIFLTEIASLPRGVTRLRMLRHLIAGKAVASYFGLEDVFTGVKVPNGLWRSLDLNVLTGISASSNLVEQLASFTQLRSLKLTDVKNIHYTKLFASIRKMQLLKNLLIGTANSDEYVSLEALDPAPQNLEILFVKGRLHDRVIGSDLFEANRLTLMELTLENSRLSIDPLPSLSNFCNLTLLGLFNHYIGETLLFQAEWFPKLHTLTLAELQNVSSIVIEKHSMPNLYNFALICLTNLEDLPEGMEFLGSVEELSLVGMHQKFMEHVQGSSNVKVKHIPVVDYFDQTKGRWDRLSPLYFEDEGTKN

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
11-937 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

CKIGSILGSHLTQALVSHLGKEVSVLIEVESIVKQIRSEFRLMQSFLQDGQEKESSSRQAETFLQEVQQIAFEVEDILDEFVYYFGRKETPSVELLKNFFRKSESVMPLRRIAAELKEVQNRLQNIRNLKLQYNIDLSEESASSIRYEDSKGHTLHHIMHNKKLVGFVNERQKLQELLMANERSCSIISIWGMGGSGKTTLVKTVSESKASKNRFDCQIWVTVSQTYDITEIMRKIIQCALKDTCSADLGSMSSEGVVLMLQETLQGRTYMMVLDDVWDTNVWFSLEGFLDESSIRSKVVITTRINDVASLAEDKRRLQLRGLDEAESWDLFCMWAFRHGEDQTCPPAMDRVARQIVGRCEGLPLAITAVGNLLSFKRLDLMEWEKFYNQLNWELHNRLDNQGLSMVTRLLGLSYKHLPVHLKNCFLLCSIFPEDYMIRGKRLCKLLVVEGLVEPRKNMTLEEIAMEYIEKLVDRCLLQVARRNKLGRVWELQMHDIIRELAISISEKEGFCMIHNKAQRSVVECEPRRLSIHENSVRVQLSINASRVRSFYQFDIDCSSVSKVQWVSRTARYLKVLELGSVPIRKLPRDIGNLFNLHYLGLRRTKIKQLPESIDRLQNLRTLDIFLTEIASLPRGVTRLRMLRHLIAGKAVASYFGLEDVFTGVKVPNGLWRSLDLNVLTGISASSNLVEQLASFTQLRSLKLTDVKNIHYTKLFASIRKMQLLKNLLIGTANSDEYVSLEALDPAPQNLEILFVKGRLHDRVIGSDLFEANRLTLMELTLENSRLSIDPLPSLSNFCNLTLLGLFNHYIGETLLFQAEWFPKLHTLTLAELQNVSSIVIEKHSMPNLYNFALICLTNLEDLPEGMEFLGSVEELSLVGMHQKFMEHVQGSSNVKVKHIPVVDYFDQTKGRWDRLSPLYFEDEGTK

HMMPanther: PTHR23155:SF222
11-937 PTHR23155:SF222,OS12G0246700 PROTEIN

CKIGSILGSHLTQALVSHLGKEVSVLIEVESIVKQIRSEFRLMQSFLQDGQEKESSSRQAETFLQEVQQIAFEVEDILDEFVYYFGRKETPSVELLKNFFRKSESVMPLRRIAAELKEVQNRLQNIRNLKLQYNIDLSEESASSIRYEDSKGHTLHHIMHNKKLVGFVNERQKLQELLMANERSCSIISIWGMGGSGKTTLVKTVSESKASKNRFDCQIWVTVSQTYDITEIMRKIIQCALKDTCSADLGSMSSEGVVLMLQETLQGRTYMMVLDDVWDTNVWFSLEGFLDESSIRSKVVITTRINDVASLAEDKRRLQLRGLDEAESWDLFCMWAFRHGEDQTCPPAMDRVARQIVGRCEGLPLAITAVGNLLSFKRLDLMEWEKFYNQLNWELHNRLDNQGLSMVTRLLGLSYKHLPVHLKNCFLLCSIFPEDYMIRGKRLCKLLVVEGLVEPRKNMTLEEIAMEYIEKLVDRCLLQVARRNKLGRVWELQMHDIIRELAISISEKEGFCMIHNKAQRSVVECEPRRLSIHENSVRVQLSINASRVRSFYQFDIDCSSVSKVQWVSRTARYLKVLELGSVPIRKLPRDIGNLFNLHYLGLRRTKIKQLPESIDRLQNLRTLDIFLTEIASLPRGVTRLRMLRHLIAGKAVASYFGLEDVFTGVKVPNGLWRSLDLNVLTGISASSNLVEQLASFTQLRSLKLTDVKNIHYTKLFASIRKMQLLKNLLIGTANSDEYVSLEALDPAPQNLEILFVKGRLHDRVIGSDLFEANRLTLMELTLENSRLSIDPLPSLSNFCNLTLLGLFNHYIGETLLFQAEWFPKLHTLTLAELQNVSSIVIEKHSMPNLYNFALICLTNLEDLPEGMEFLGSVEELSLVGMHQKFMEHVQGSSNVKVKHIPVVDYFDQTKGRWDRLSPLYFEDEGTK

superfamily: SSF52540
157-409 SSF52540

YEDSKGHTLHHIMHNKKLVGFVNERQKLQELLMANERSCSIISIWGMGGSGKTTLVKTVSESKASKNRFDCQIWVTVSQTYDITEIMRKIIQCALKDTCSADLGSMSSEGVVLMLQETLQGRTYMMVLDDVWDTNVWFSLEGFLDESSIRSKVVITTRINDVASLAEDKRRLQLRGLDEAESWDLFCMWAFRHGEDQTCPPAMDRVARQIVGRCEGLPLAITAVGNLLSFKRLDLMEWEKFYNQLNWELHNRL

Gene3D: G3DSA:3.40.50.300
169-252 G3DSA:3.40.50.300

MHNKKLVGFVNERQKLQELLMANERSCSIISIWGMGGSGKTTLVKTVSESKASKNRFDCQIWVTVSQTYDITEIMRKIIQCALK

HMMPfam: PF00931
IPR002182
182-467 NB-ARC,NBS
NB-ARC

QKLQELLMANERSCSIISIWGMGGSGKTTLVKTVSESKASKNRFDCQIWVTVSQTYDITEIMRKIIQCALKDTCSADLGSMSSEGVVLMLQETLQGRTYMMVLDDVWDTNVWFSLEGFLDESSIRSKVVITTRINDVASLAEDKRRLQLRGLDEAESWDLFCMWAFRHGEDQTCPPAMDRVARQIVGRCEGLPLAITAVGNLLSFKRLDLMEWEKFYNQLNWELHNRLDNQGLSMVTRLLGLSYKHLPVHLKNCFLLCSIFPEDYMIRGKRLCKLLVVEGLVEPRK

FPrintScan: PR00364
IPR000767
197-212 DISEASERSIST
Disease resistance protein

IISIWGMGGSGKTTLV

FPrintScan: PR00364
IPR000767
274-288 DISEASERSIST
Disease resistance protein

TLQGRTYMMVLDDVW

FPrintScan: PR00364
IPR000767
370-384 DISEASERSIST
Disease resistance protein

CEGLPLAITAVGNLL

superfamily: SSF52058
503-938 SSF52058,LRR

QMHDIIRELAISISEKEGFCMIHNKAQRSVVECEPRRLSIHENSVRVQLSINASRVRSFYQFDIDCSSVSKVQWVSRTARYLKVLELGSVPIRKLPRDIGNLFNLHYLGLRRTKIKQLPESIDRLQNLRTLDIFLTEIASLPRGVTRLRMLRHLIAGKAVASYFGLEDVFTGVKVPNGLWRSLDLNVLTGISASSNLVEQLASFTQLRSLKLTDVKNIHYTKLFASIRKMQLLKNLLIGTANSDEYVSLEALDPAPQNLEILFVKGRLHDRVIGSDLFEANRLTLMELTLENSRLSIDPLPSLSNFCNLTLLGLFNHYIGETLLFQAEWFPKLHTLTLAELQNVSSIVIEKHSMPNLYNFALICLTNLEDLPEGMEFLGSVEELSLVGMHQKFMEHVQGSSNVKVKHIPVVDYFDQTKGRWDRLSPLYFEDEGTKN

Gene3D: G3DSA:3.80.10.10
582-764 G3DSA:3.80.10.10

RYLKVLELGSVPIRKLPRDIGNLFNLHYLGLRRTKIKQLPESIDRLQNLRTLDIFLTEIASLPRGVTRLRMLRHLIAGKAVASYFGLEDVFTGVKVPNGLWRSLDLNVLTGISASSNLVEQLASFTQLRSLKLTDVKNIHYTKLFASIRKMQLLKNLLIGTANSDEYVSLEALDPAPQNLEIL

FPrintScan: PR00364
IPR000767
704-720 DISEASERSIST
Disease resistance protein

ASFTQLRSLKLTDVKNI

Gene3D: G3DSA:3.80.10.10
787-892 G3DSA:3.80.10.10

LMELTLENSRLSIDPLPSLSNFCNLTLLGLFNHYIGETLLFQAEWFPKLHTLTLAELQNVSSIVIEKHSMPNLYNFALICLTNLEDLPEGMEFLGSVEELSLVGMH


List of References




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox