PRGDB00049864 (Os12g0237900)

From PRG Wiki
Jump to: navigation, search
Os12g0237900
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 115487959 (NM_001072999)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa (japonica cultivar-group) Os12g0237900 (Os12g0237900) mRNA, complete cds.

DNA Sequence

ATGTCGACGATGGTGGTGAGCGCATACAAGGGGGTGATTGACTCTGTTCTTGCAAAGCTCAGAGAGCTGATGGGAGGGGACATGTGTGCCAACCTCATAGGCGTGTCCAGCAGGGACATTTTGTTCCTCAGGGATGAGCTGCCTGCCATGAGTGCTCTCCTGGAGAAGCTGGATGATGCCGAAGAACTCGATTCGGAGGCGAAAAATTGGAGGAACCAAGTGAGGGAGATGACCTACGACATCGAGGACTGCATCGATGATTTCAGTAACAACATCACAAGCGTAGACGCTAAGACGGGGTTCCTCTACAAGGCTTCCCAATTTCTCAAGACTTGCAGGGCTCATCTTGAGGCTGCCTGGCAAATCAAAGAGCTCAAGACTCGTCTACAGGAGATAAACGAGCGGCGTAAGAGGTACAAGGTTGGACATTACATCTCTAATACTACCTCAGTGACAGTTGACCCTCGCATCTCGGCATTCTATAAGGAGACAGCCGGCCTTGTAGGCATTGACAGCCCAAAGAGAGAGCTCACTAAATTGGTGATGGACGAAGAGACGCAATTGAAGGTTATGTCAATAGTTGGATTTGGAGGCCTAGGCAAGACCACCCTAGCTAGTCAGGTGTATCGTGAAGTTGGAGTGCAGTTCAACTGTAAGGCATTTGTATCTGTTTCTCAAAAACCAGACATGGTAAGGCTACTCACAAGTTTGCTGTTACAACTCAAGCAACATCCCTCTCATGCTTGTGGGGTGCAAGAACTCATCGACAATCTCAGGGAATATCTAATGGATAAAAGGTACTTCATTGTAGTTGATGATTTGTGGGATGTTCCTTCATGGAATATTATTACATGTGCTTTTCCACAAAATAATCAACATAGCAGAGTTATAATAACTACAAGACACGGGGATGTGGCTAGGACATGTTCCAGTGACCATGGAAGCATTAACAATATGAAGCCCCTAAGTGCCCAAAACTCAAGAGAACTATTCTTCAACAGAATATTTGGGTCTAAAGATTATTGTCCCTCTTACTTGGAAGAAGTCTCATGTAAAATACTGAAGAAGTGTGGTGGCCTACCGCTTGCAATTGTTACTGTAGCTAGTATTTTAGCTTGCCAACCCACAAGACTGAAGGAGGAATGGGAGTACATTCAAAGTTCTCTAGCCACTAACAAATTTGCAAGGAAGTCCACCTTGGAAGACATGATGCAAATCTTGGAGCTCAGCTACAAGAGTCTGCCACATCATCTCAAAGCATGCTTTCTTTATCTTGGTGCTTACCCAGAGGATTGTGTGATTAGCAAGGTTGATCTTATTAAAAGGTGGGTAGCAGAAGGTTTTGTGAGTCACTCTCCTGGGCAAGATGCATGGGTTGTTGCAGAGAGCTATTTCAATGAGCTGGTGAATAGAAGCATGATTCAACTTCCATATCAGGGCTACTACAATGAAGTATCTCATTGCAAGGTTCATGATATGATGCTAGACATGATTCTAATGAGGTGCAAGGAAGATAATTTCATCAGTGTGATACAAGATCCACGAGCGGCGATAGAAGTTCAAGACAAGATTCGTCGGCTCACCATTGACTTGAATGGTGCCATGGGTGACACAATGGATATGAACATTACTAGGAAAGTGTCACAAGTTCGTTCTCTTGGTGTATTTGGAGGATCAAAGTGGATACCTCCTTTGTTGGAGTTTAAGTTTCTGCGGGTGTTATTCCTTGAATTCTTTCTACGAGAGATGATAATTGACCTCACTGGTATCAACCAACTGTCCCAGCTGAGATATTTAAAGGTTGAATGCAAGGAATGCCTAATGGATGGTGACATACCATCACAAGTTTCCATAGTGTTACCAAGTCAAATCCGAAGGCTACAACATTTGGAAACCTTGGAGTTACCCTGGGTATCAAAATGCAGCATCCCATCAATATCAGGCATCATTGATTTGCCGCGCTTGACCCATCTAGTGTTGCGACAGCATAAGGGGGGATTACCGGATGGGATTAGAAAATTGAAGTCATTGCGCACTTTGCATGGCTTTAATCTACCAGTAAGCTCATTGGAAAATATTGATGCCCTGGGTGAGCTCACTAGTCTAGCAGATATGTCACTCCATTGTGGCAAACAAGACACAAAATCTACTACTCCAGGATGGATGACTGCTCTGAGTTGTTCCATCGAGAAACTCGGTAATCTCAAAGGTCTTTATGTGAGGTCTAATAGTCCTAGCTGTTGCGCCGATGCGATGAGCAGCTGGTTTTCACCTCCATTTCTCAACCTTGAGAAGCTTGATCTGCTAGATTGGACATTCTCCAAAGTTCCTAGATGGATTGGCCAACTCCATAGCCTCCGTGAGTTGGCACTTGGGGGCAAGAAGATACTCCAGGAAGATGTTAGTATGATCGGCACAATGCTACCCTTCCTCACCCATCTAAGCCTACGTATTGTTACATGCAATATCGCGGTGAAGGAAAGCAGGATCATGATAGAAGGCTCCATAGGATTCGCTGCTCTCCGGTTTTTCTGTTTTGACTCTAATAGGATGTCACACCTAGAGTTTGGGGTAGGTGCTATGCCCCAGCTCAAGAGGCTGCTATTAGCACTTGATCCATGGGAATGGGATGAGGCCACACCTGTTGGACTTAAACACCTCTTGTACCTCGAGGAAATACGAGTATTGACAGCATCAACAGCTGTTGCTTCTGCAGGATCTGAATCAATGAATGGCAAGTCTGCACTAGTCAAGGGTGTGTTCCATGATGCCGCTAATGCTCTCCAGAGTCGCCCAGCATTTACCGTGCTCCCAAGGATCCGTTCTCTCTCTGATCACGTAAATTGTTGTAAAATTAATATGGAAACAGTTGCATGTAAGTAG


Protein sequences

Name Description Sequence
hypothetical protein Os12g0237900 [Oryza sativa (japonica cultivar-group)].

MSTMVVSAYKGVIDSVLAKLRELMGGDMCANLIGVSSRDILFLRDELPAMSALLEKLDDAEELDSEAKNWRNQVREMTYDIEDCIDDFSNNITSVDAKTGFLYKASQFLKTCRAHLEAAWQIKELKTRLQEINERRKRYKVGHYISNTTSVTVDPRISAFYKETAGLVGIDSPKRELTKLVMDEETQLKVMSIVGFGGLGKTTLASQVYREVGVQFNCKAFVSVSQKPDMVRLLTSLLLQLKQHPSHACGVQELIDNLREYLMDKRYFIVVDDLWDVPSWNIITCAFPQNNQHSRVIITTRHGDVARTCSSDHGSINNMKPLSAQNSRELFFNRIFGSKDYCPSYLEEVSCKILKKCGGLPLAIVTVASILACQPTRLKEEWEYIQSSLATNKFARKSTLEDMMQILELSYKSLPHHLKACFLYLGAYPEDCVISKVDLIKRWVAEGFVSHSPGQDAWVVAESYFNELVNRSMIQLPYQGYYNEVSHCKVHDMMLDMILMRCKEDNFISVIQDPRAAIEVQDKIRRLTIDLNGAMGDTMDMNITRKVSQVRSLGVFGGSKWIPPLLEFKFLRVLFLEFFLREMIIDLTGINQLSQLRYLKVECKECLMDGDIPSQVSIVLPSQIRRLQHLETLELPWVSKCSIPSISGIIDLPRLTHLVLRQHKGGLPDGIRKLKSLRTLHGFNLPVSSLENIDALGELTSLADMSLHCGKQDTKSTTPGWMTALSCSIEKLGNLKGLYVRSNSPSCCADAMSSWFSPPFLNLEKLDLLDWTFSKVPRWIGQLHSLRELALGGKKILQEDVSMIGTMLPFLTHLSLRIVTCNIAVKESRIMIEGSIGFAALRFFCFDSNRMSHLEFGVGAMPQLKRLLLALDPWEWDEATPVGLKHLLYLEEIRVLTASTAVASAGSESMNGKSALVKGVFHDAANALQSRPAFTVLPRIRSLSDHVNCCKINMETVACK

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017:SF126
16-708 PTHR11017:SF126,OS11G0237600 PROTEIN

VLAKLRELMGGDMCANLIGVSSRDILFLRDELPAMSALLEKLDDAEELDSEAKNWRNQVREMTYDIEDCIDDFSNNITSVDAKTGFLYKASQFLKTCRAHLEAAWQIKELKTRLQEINERRKRYKVGHYISNTTSVTVDPRISAFYKETAGLVGIDSPKRELTKLVMDEETQLKVMSIVGFGGLGKTTLASQVYREVGVQFNCKAFVSVSQKPDMVRLLTSLLLQLKQHPSHACGVQELIDNLREYLMDKRYFIVVDDLWDVPSWNIITCAFPQNNQHSRVIITTRHGDVARTCSSDHGSINNMKPLSAQNSRELFFNRIFGSKDYCPSYLEEVSCKILKKCGGLPLAIVTVASILACQPTRLKEEWEYIQSSLATNKFARKSTLEDMMQILELSYKSLPHHLKACFLYLGAYPEDCVISKVDLIKRWVAEGFVSHSPGQDAWVVAESYFNELVNRSMIQLPYQGYYNEVSHCKVHDMMLDMILMRCKEDNFISVIQDPRAAIEVQDKIRRLTIDLNGAMGDTMDMNITRKVSQVRSLGVFGGSKWIPPLLEFKFLRVLFLEFFLREMIIDLTGINQLSQLRYLKVECKECLMDGDIPSQVSIVLPSQIRRLQHLETLELPWVSKCSIPSISGIIDLPRLTHLVLRQHKGGLPDGIRKLKSLRTLHGFNLPVSSLENIDALGELTSLADMSLH

HMMPanther: PTHR11017
16-708 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

VLAKLRELMGGDMCANLIGVSSRDILFLRDELPAMSALLEKLDDAEELDSEAKNWRNQVREMTYDIEDCIDDFSNNITSVDAKTGFLYKASQFLKTCRAHLEAAWQIKELKTRLQEINERRKRYKVGHYISNTTSVTVDPRISAFYKETAGLVGIDSPKRELTKLVMDEETQLKVMSIVGFGGLGKTTLASQVYREVGVQFNCKAFVSVSQKPDMVRLLTSLLLQLKQHPSHACGVQELIDNLREYLMDKRYFIVVDDLWDVPSWNIITCAFPQNNQHSRVIITTRHGDVARTCSSDHGSINNMKPLSAQNSRELFFNRIFGSKDYCPSYLEEVSCKILKKCGGLPLAIVTVASILACQPTRLKEEWEYIQSSLATNKFARKSTLEDMMQILELSYKSLPHHLKACFLYLGAYPEDCVISKVDLIKRWVAEGFVSHSPGQDAWVVAESYFNELVNRSMIQLPYQGYYNEVSHCKVHDMMLDMILMRCKEDNFISVIQDPRAAIEVQDKIRRLTIDLNGAMGDTMDMNITRKVSQVRSLGVFGGSKWIPPLLEFKFLRVLFLEFFLREMIIDLTGINQLSQLRYLKVECKECLMDGDIPSQVSIVLPSQIRRLQHLETLELPWVSKCSIPSISGIIDLPRLTHLVLRQHKGGLPDGIRKLKSLRTLHGFNLPVSSLENIDALGELTSLADMSLH

superfamily: SSF52540
150-396 SSF52540

SVTVDPRISAFYKETAGLVGIDSPKRELTKLVMDEETQLKVMSIVGFGGLGKTTLASQVYREVGVQFNCKAFVSVSQKPDMVRLLTSLLLQLKQHPSHACGVQELIDNLREYLMDKRYFIVVDDLWDVPSWNIITCAFPQNNQHSRVIITTRHGDVARTCSSDHGSINNMKPLSAQNSRELFFNRIFGSKDYCPSYLEEVSCKILKKCGGLPLAIVTVASILACQPTRLKEEWEYIQSSLATNKFAR

Gene3D: G3DSA:3.40.50.300
169-290 G3DSA:3.40.50.300

GIDSPKRELTKLVMDEETQLKVMSIVGFGGLGKTTLASQVYREVGVQFNCKAFVSVSQKPDMVRLLTSLLLQLKQHPSHACGVQELIDNLREYLMDKRYFIVVDDLWDVPSWNIITCAFPQN

HMMPfam: PF00931
IPR002182
175-451 NB-ARC,NBS
NB-ARC

RELTKLVMDEETQLKVMSIVGFGGLGKTTLASQVYREVGVQFNCKAFVSVSQKPDMVRLLTSLLLQLKQHPSHACGVQELIDNLREYLMDKRYFIVVDDLWDVPSWNIITCAFPQNNQHSRVIITTRHGDVARTCSSDHGSINNMKPLSAQNSRELFFNRIFGSKDYCPSYLEEVSCKILKKCGGLPLAIVTVASILACQPTRLKEEWEYIQSSLATNKFARKSTLEDMMQILELSYKSLPHHLKACFLYLGAYPEDCVISKVDLIKRWVAEGFVSH

FPrintScan: PR00364
IPR000767
190-205 DISEASERSIST
Disease resistance protein

VMSIVGFGGLGKTTLA

FPrintScan: PR00364
IPR000767
261-275 DISEASERSIST
Disease resistance protein

YLMDKRYFIVVDDLW

FPrintScan: PR00364
IPR000767
357-371 DISEASERSIST
Disease resistance protein

CGGLPLAIVTVASIL

superfamily: SSF52058
489-895 SSF52058,LRR

KVHDMMLDMILMRCKEDNFISVIQDPRAAIEVQDKIRRLTIDLNGAMGDTMDMNITRKVSQVRSLGVFGGSKWIPPLLEFKFLRVLFLEFFLREMIIDLTGINQLSQLRYLKVECKECLMDGDIPSQVSIVLPSQIRRLQHLETLELPWVSKCSIPSISGIIDLPRLTHLVLRQHKGGLPDGIRKLKSLRTLHGFNLPVSSLENIDALGELTSLADMSLHCGKQDTKSTTPGWMTALSCSIEKLGNLKGLYVRSNSPSCCADAMSSWFSPPFLNLEKLDLLDWTFSKVPRWIGQLHSLRELALGGKKILQEDVSMIGTMLPFLTHLSLRIVTCNIAVKESRIMIEGSIGFAALRFFCFDSNRMSHLEFGVGAMPQLKRLLLALDPWEWDEATPVGLKHLLYLEEIRV

Gene3D: G3DSA:3.80.10.10
585-735 G3DSA:3.80.10.10

IDLTGINQLSQLRYLKVECKECLMDGDIPSQVSIVLPSQIRRLQHLETLELPWVSKCSIPSISGIIDLPRLTHLVLRQHKGGLPDGIRKLKSLRTLHGFNLPVSSLENIDALGELTSLADMSLHCGKQDTKSTTPGWMTALSCSIEKLGNL

FPrintScan: PR00364
IPR000767
625-641 DISEASERSIST
Disease resistance protein

RRLQHLETLELPWVSKC

Gene3D: G3DSA:3.80.10.10
736-881 G3DSA:3.80.10.10

KGLYVRSNSPSCCADAMSSWFSPPFLNLEKLDLLDWTFSKVPRWIGQLHSLRELALGGKKILQEDVSMIGTMLPFLTHLSLRIVTCNIAVKESRIMIEGSIGFAALRFFCFDSNRMSHLEFGVGAMPQLKRLLLALDPWEWDEATP


List of References




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox