PRGDB00049865 (Os12g0205500)

From PRG Wiki
Jump to: navigation, search
Os12g0205500
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 115487789 (NM_001072914)
Gene Class NL
Domain Type LRR, NBS, LRR, LRR, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa (japonica cultivar-group) Os12g0205500 (Os12g0205500) mRNA, complete cds.

DNA Sequence

ATGGTGTCCGCTTGGACCATCGTCCCCGGCATCATCGTTTCGCTGATCGTGCTTGTGGTCACCAAGCTGTGGGATCCAATCGCCCAGGTCTACGGGTACCCGTTCGATGCGGAAAGGCGCGTGCAGAAACTCGTCGATGAGTTCTCCAAGCTGCAAGATCAGTTGGGCGAGCTGGGGATTTTGGATCCCAAACCCTCGTCCGCAGTGCTCTCGGGTTGGCTGCAGCGGGCGGCTGGATGCAAGGACAAGGTGGAGGAGATAAAGCGCCGACATGAATCTGTGAAGAGCGTGGGGGTCCAGGGCCTCCTACCCCGGATCAACGTGGTCCGGCACCTCTGCGCCATCGGCAGGGATGCAGATCTGGAGCTAGAAGAAGTCAAGGATCTCATCGCCAAAGGAGAGGGCCACTTGAAGGAGGCGGGTGCTGCTCCCCATCCGATTCCGATTCCGATTCCTCTACTACCTCCACCGGCGGCAGAATTCGACAACGGCCAGCTTGCCCAGTCAATCCTCGACACGGCAGCGGCCGGCACATGGGGAGTTGGGATCCAGGCAATGAAACCTCACCTGACCAGCGTCCTAGATTTTGTCCGGGAAGACGGCGGCGGAGCTCCTGGCGTGCTAGGAGTATGGGGCATGGGCGGCGCCGGCAAAACCACGCTTCTCAAGCTCGCGCGCGATCCACGAGTACAAACCTTGGACCATATTGTTCTCGCTGAGGCTGGCAAGTGCTGCGATATCGCCAAGCTTCAGGACAGCATTGCACAGGGCACGAGCCTGGTGTTGCCTCCTTCGCTCAGTGTCACCAACCGTGCTACCGTCCTGTGCAACCATCTTCGCAACAAGAAATTCTTGCTGCTGCTGGATGACCTGTGGAACTACATTGATTTGGAGGCTGTCGGCATCCCGTTGCCCCTTGGACGGGGGAATCAACGTAAGGTTGTATTGACATCACGAAGCGAGGCCGTATGTGTCAGCATGGCACGCCAAGGAGTTACCATCAGAATGGGGTGCCTAGATCAACAAGATGCGTTCAAGCTCTTCGAGGATAAAGTTGGGAGTGCTACCATCAATGCTGATACTAGGATTCCAGAGCTTGCCAGGCAGGTAGCCGAAATGTGCGGTGGTCTGCCATTAGTGCTGTGCGTCATCGGTCGATCCATGTGCACGAAGAAGAATTATAAGCTGTGGGTGGATGCAGTCAACAGGTTGGAGAAGTCAAAGGTCCATAATAACCTAGTTGGAGACGATGATATATTCAACATCCTAAGGTACAGCTTCGATGGACTACATGACGACGAAGCACGGGGTTGTTTTCTGGCGTGCACCCTGTTCCCTCCATTTTACATTGAGAAGAAGCGACTCATCCGGTGGTGTATGGGGCTTGGTTTCTTGGATCCCGCCAACGGTTTTGAAGGAGGAGAGTCTGTCATCGATTCCCTGCAGGGAGCATCGCTCCTGGAGAGCGCTGGAAGCTATTCTGTTGATATGCACGACATCATCCGCGACATGGCGCTGTGGATTGTAAGGGGCCCTGGAGGTGAGAAGTGGAGCGTGCTGAATCGAGCATGGGTGCAGGATGCAACCATACGCAAAATGAACAACGGGTATTGGACTCGGGAAGAATGGCCTCCCAAGGATACATGGCCTGAGCTTGAGATGCTTGCGATGGAAAGCAATCGCTCCTACCTTGATCCGTGGAAGGTTTCGTCCATCGGCCAGATGACAAACATCAGCTTTCTGGAACTGGTGTCTTTAGATACATTTCCAATGGAGATCTGTGAGCTGCATAAGCTCGAATACCTCTGCATCAAAGCAGGGAGTATGTCTAGGCTGCCAATTGAACTCGGGAAACTGTCGAAACTCAAGCAATTGCATCTGCGGCAGTCTTGCAGTCTTGGCGAGATACCGACAGGATTGATCTCGCAGCTCGTAAACCTGCAGGTGCTGGACCTTTTCTGCAGCAGCATCGATTATCCCTACCGTCCAAAATCTGCTGCTGGTGGCCTTTACAATTTTCTGGGTGAACTGGCCGAAGCTAGAGCATCGGAGAAGTTGAAGATTCTTGGGATTTGCCTGGATGCGACGCGTGATAATAGGGCATTTCTGAAGCAGTTGATGCAGAAGCAAGTGCGAATAAGGTCGCTCTGCTTAAGCTTCATCAATCCAATCTCGCCTGGACATGATCAACCCCAGCCGGCCACCAGCAGATACATGATCGCCGAACTGCAACCGTTCTCCAATGATCTGGGAGAACTAGCCATTTCTAGTTCCGACATCTTGCAGGAGCTTGTGGCCACGTCTGATGGAAAGGAGCTGATCCAAAACCTGGAACATCTCTGCTTGGAAAATCTCAATGTACTGGAGAGAGTAATATGGCTGAACGCGGCGAGAAACCTTCGAAGGGTTGACATCAAGAAATGTGCAAAATTGACGCACGCCACATGGGTATTGCAGCTTGGGTACCTCGAGGAACTCGGCATTCATGATTGCCCACAGTTTAAACGGTTGATCGACCATAAGGAGCTTGCGGAGAATCCACCAGATCATGTGATCTTCCCTCGGCTTACATATCTCGATCTCAGTGATCTGCCAGAATTGTCTGATATATGTGTGCTGCCTTGTGAATTTAAGTCGTCGCTGGCGCTTCTTGTTGAGAACTGCGACAAGCTGATGAACATATCGTTCCACTACCCACCCGGTCATGACCAGAAAAATATTAGGGTTTTCTGCGACAATGAATGGTTCAATAGACTCGAGTGCAAGCCAAATATCATGAAGTCCTACCTATCGCAAAACATGAGATTTTCTGCTATTTGA


Protein sequences

Name Description Sequence
hypothetical protein Os12g0205500 [Oryza sativa (japonica cultivar-group)].

MVSAWTIVPGIIVSLIVLVVTKLWDPIAQVYGYPFDAERRVQKLVDEFSKLQDQLGELGILDPKPSSAVLSGWLQRAAGCKDKVEEIKRRHESVKSVGVQGLLPRINVVRHLCAIGRDADLELEEVKDLIAKGEGHLKEAGAAPHPIPIPIPLLPPPAAEFDNGQLAQSILDTAAAGTWGVGIQAMKPHLTSVLDFVREDGGGAPGVLGVWGMGGAGKTTLLKLARDPRVQTLDHIVLAEAGKCCDIAKLQDSIAQGTSLVLPPSLSVTNRATVLCNHLRNKKFLLLLDDLWNYIDLEAVGIPLPLGRGNQRKVVLTSRSEAVCVSMARQGVTIRMGCLDQQDAFKLFEDKVGSATINADTRIPELARQVAEMCGGLPLVLCVIGRSMCTKKNYKLWVDAVNRLEKSKVHNNLVGDDDIFNILRYSFDGLHDDEARGCFLACTLFPPFYIEKKRLIRWCMGLGFLDPANGFEGGESVIDSLQGASLLESAGSYSVDMHDIIRDMALWIVRGPGGEKWSVLNRAWVQDATIRKMNNGYWTREEWPPKDTWPELEMLAMESNRSYLDPWKVSSIGQMTNISFLELVSLDTFPMEICELHKLEYLCIKAGSMSRLPIELGKLSKLKQLHLRQSCSLGEIPTGLISQLVNLQVLDLFCSSIDYPYRPKSAAGGLYNFLGELAEARASEKLKILGICLDATRDNRAFLKQLMQKQVRIRSLCLSFINPISPGHDQPQPATSRYMIAELQPFSNDLGELAISSSDILQELVATSDGKELIQNLEHLCLENLNVLERVIWLNAARNLRRVDIKKCAKLTHATWVLQLGYLEELGIHDCPQFKRLIDHKELAENPPDHVIFPRLTYLDLSDLPELSDICVLPCEFKSSLALLVENCDKLMNISFHYPPGHDQKNIRVFCDNEWFNRLECKPNIMKSYLSQNMRFSAI

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF103
12-939 PTHR23155:SF103,OS12G0205500 PROTEIN

IVSLIVLVVTKLWDPIAQVYGYPFDAERRVQKLVDEFSKLQDQLGELGILDPKPSSAVLSGWLQRAAGCKDKVEEIKRRHESVKSVGVQGLLPRINVVRHLCAIGRDADLELEEVKDLIAKGEGHLKEAGAAPHPIPIPIPLLPPPAAEFDNGQLAQSILDTAAAGTWGVGIQAMKPHLTSVLDFVREDGGGAPGVLGVWGMGGAGKTTLLKLARDPRVQTLDHIVLAEAGKCCDIAKLQDSIAQGTSLVLPPSLSVTNRATVLCNHLRNKKFLLLLDDLWNYIDLEAVGIPLPLGRGNQRKVVLTSRSEAVCVSMARQGVTIRMGCLDQQDAFKLFEDKVGSATINADTRIPELARQVAEMCGGLPLVLCVIGRSMCTKKNYKLWVDAVNRLEKSKVHNNLVGDDDIFNILRYSFDGLHDDEARGCFLACTLFPPFYIEKKRLIRWCMGLGFLDPANGFEGGESVIDSLQGASLLESAGSYSVDMHDIIRDMALWIVRGPGGEKWSVLNRAWVQDATIRKMNNGYWTREEWPPKDTWPELEMLAMESNRSYLDPWKVSSIGQMTNISFLELVSLDTFPMEICELHKLEYLCIKAGSMSRLPIELGKLSKLKQLHLRQSCSLGEIPTGLISQLVNLQVLDLFCSSIDYPYRPKSAAGGLYNFLGELAEARASEKLKILGICLDATRDNRAFLKQLMQKQVRIRSLCLSFINPISPGHDQPQPATSRYMIAELQPFSNDLGELAISSSDILQELVATSDGKELIQNLEHLCLENLNVLERVIWLNAARNLRRVDIKKCAKLTHATWVLQLGYLEELGIHDCPQFKRLIDHKELAENPPDHVIFPRLTYLDLSDLPELSDICVLPCEFKSSLALLVENCDKLMNISFHYPPGHDQKNIRVFCDNEWFNRLECKPNIMKSYLSQNMRFSAI

HMMPanther: PTHR23155
12-939 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

IVSLIVLVVTKLWDPIAQVYGYPFDAERRVQKLVDEFSKLQDQLGELGILDPKPSSAVLSGWLQRAAGCKDKVEEIKRRHESVKSVGVQGLLPRINVVRHLCAIGRDADLELEEVKDLIAKGEGHLKEAGAAPHPIPIPIPLLPPPAAEFDNGQLAQSILDTAAAGTWGVGIQAMKPHLTSVLDFVREDGGGAPGVLGVWGMGGAGKTTLLKLARDPRVQTLDHIVLAEAGKCCDIAKLQDSIAQGTSLVLPPSLSVTNRATVLCNHLRNKKFLLLLDDLWNYIDLEAVGIPLPLGRGNQRKVVLTSRSEAVCVSMARQGVTIRMGCLDQQDAFKLFEDKVGSATINADTRIPELARQVAEMCGGLPLVLCVIGRSMCTKKNYKLWVDAVNRLEKSKVHNNLVGDDDIFNILRYSFDGLHDDEARGCFLACTLFPPFYIEKKRLIRWCMGLGFLDPANGFEGGESVIDSLQGASLLESAGSYSVDMHDIIRDMALWIVRGPGGEKWSVLNRAWVQDATIRKMNNGYWTREEWPPKDTWPELEMLAMESNRSYLDPWKVSSIGQMTNISFLELVSLDTFPMEICELHKLEYLCIKAGSMSRLPIELGKLSKLKQLHLRQSCSLGEIPTGLISQLVNLQVLDLFCSSIDYPYRPKSAAGGLYNFLGELAEARASEKLKILGICLDATRDNRAFLKQLMQKQVRIRSLCLSFINPISPGHDQPQPATSRYMIAELQPFSNDLGELAISSSDILQELVATSDGKELIQNLEHLCLENLNVLERVIWLNAARNLRRVDIKKCAKLTHATWVLQLGYLEELGIHDCPQFKRLIDHKELAENPPDHVIFPRLTYLDLSDLPELSDICVLPCEFKSSLALLVENCDKLMNISFHYPPGHDQKNIRVFCDNEWFNRLECKPNIMKSYLSQNMRFSAI

HMMPfam: PF00931
IPR002182
189-467 NB-ARC,NBS
NB-ARC

HLTSVLDFVREDGGGAPGVLGVWGMGGAGKTTLLKLARDPRVQTLDHIVLAEAGKCCDIAKLQDSIAQGTSLVLPPSLSVTNRATVLCNHLRNKKFLLLLDDLWNYIDLEAVGIPLPLGRGNQRKVVLTSRSEAVCVSMARQGVTIRMGCLDQQDAFKLFEDKVGSATINADTRIPELARQVAEMCGGLPLVLCVIGRSMCTKKNYKLWVDAVNRLEKSKVHNNLVGDDDIFNILRYSFDGLHDDEARGCFLACTLFPPFYIEKKRLIRWCMGLGFLDP

superfamily: SSF52540
203-413 SSF52540

GAPGVLGVWGMGGAGKTTLLKLARDPRVQTLDHIVLAEAGKCCDIAKLQDSIAQGTSLVLPPSLSVTNRATVLCNHLRNKKFLLLLDDLWNYIDLEAVGIPLPLGRGNQRKVVLTSRSEAVCVSMARQGVTIRMGCLDQQDAFKLFEDKVGSATINADTRIPELARQVAEMCGGLPLVLCVIGRSMCTKKNYKLWVDAVNRLEKSKVHNNL

FPrintScan: PR00364
IPR000767
207-222 DISEASERSIST
Disease resistance protein

VLGVWGMGGAGKTTLL

Gene3D: G3DSA:3.80.10.10
271-297 G3DSA:3.80.10.10

RATVLCNHLRNKKFLLLLDDLWNYIDL

FPrintScan: PR00364
IPR000767
278-292 DISEASERSIST
Disease resistance protein

HLRNKKFLLLLDDLW

FPrintScan: PR00364
IPR000767
374-388 DISEASERSIST
Disease resistance protein

CGGLPLVLCVIGRSM

superfamily: SSF52058
496-908 SSF52058,LRR

DMHDIIRDMALWIVRGPGGEKWSVLNRAWVQDATIRKMNNGYWTREEWPPKDTWPELEMLAMESNRSYLDPWKVSSIGQMTNISFLELVSLDTFPMEICELHKLEYLCIKAGSMSRLPIELGKLSKLKQLHLRQSCSLGEIPTGLISQLVNLQVLDLFCSSIDYPYRPKSAAGGLYNFLGELAEARASEKLKILGICLDATRDNRAFLKQLMQKQVRIRSLCLSFINPISPGHDQPQPATSRYMIAELQPFSNDLGELAISSSDILQELVATSDGKELIQNLEHLCLENLNVLERVIWLNAARNLRRVDIKKCAKLTHATWVLQLGYLEELGIHDCPQFKRLIDHKELAENPPDHVIFPRLTYLDLSDLPELSDICVLPCEFKSSLALLVENCDKLMNISFHYPPGHDQKNIR

Gene3D: G3DSA:3.80.10.10
550-657 G3DSA:3.80.10.10

PELEMLAMESNRSYLDPWKVSSIGQMTNISFLELVSLDTFPMEICELHKLEYLCIKAGSMSRLPIELGKLSKLKQLHLRQSCSLGEIPTGLISQLVNLQVLDLFCSSI

FPrintScan: PR00364
IPR000767
617-633 DISEASERSIST
Disease resistance protein

GKLSKLKQLHLRQSCSL

Gene3D: G3DSA:3.80.10.10
776-896 G3DSA:3.80.10.10

NLEHLCLENLNVLERVIWLNAARNLRRVDIKKCAKLTHATWVLQLGYLEELGIHDCPQFKRLIDHKELAENPPDHVIFPRLTYLDLSDLPELSDICVLPCEFKSSLALLVENCDKLMNISF


List of References




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox