PRGDB00049866 (Os12g0204800)

From PRG Wiki
Jump to: navigation, search
Os12g0204800
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 115487785 (NM_001072912)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa (japonica cultivar-group) Os12g0204800 (Os12g0204800) mRNA, complete cds.

DNA Sequence

ATGGAAACCGCTGTACTAGTGTTTGCAGGGAAGTCACTCGCAACCCCTGCAATCTCCTTCTTTGTCAACAAGGCATTCAGCTACCTGAACGAGTACCGCAAGGCTGAAGGATTGGAGGCCGTGAAGAACAGGCTAGAGGAGAACATACCCAAGATCCAATCAGTGATCGATGTCGCTGATCCTGATTACATCAAGGACAAGAGTGAAGCCCTAGATGCATGGCTGTGGCAGCTCAGAGATGCAGTCGAGGAGGCTGAGGATGCCATCGATGAGCTCGAAGTGGAGAGGGATCAAAATAAGGTTAGTCATCAGGCCGGCTCTTCTTCTTTTACACGGATGAAGCATAAATTTGTCCAGTCTGTTAAGCATGTTAGAGTGTTGGGTACGACATCTAATTCCCCTCTCAAGAGGTTAAAGAAAGCCTTGGAAGGTTTAGATGAGGCTGCTAAAGGAGTCAAGAATTTTCTCACACTTGTACAAATTCATCAAAACACAAGATCCAACTTAAACAATCCAGAACAAGATGATATTAGCTTCCGTGCCAAGGGGAAGGACTTAAATGCTGATAGGGTGTTCGGTAGAGAAAATGAGAAGGAACATATTGTTGGATGGCTGACCAATACATCAAGTGAAGATAACCAAGATGCCAAGAACAATAATCATGTCCCCATTATGTCAATAGTTGGCCATGGCGGCATTGGGAAAACCACTTTGGCTCAGCTCATCTCCCATGACTCCAGAATCAAGAAACATTTTGACACCGTGATCTGGGTTGCTGTATCTATGAGCTTTGATGCAAAAACATTGCTTGATAAAATAATTCAGTCTGTTACATTATTAAAACCTAGTGTTGATACCTACGAGGCACTGCAACAGCATTTGAAAAAGGAGATTGAGACCATTAAATATCTTCTAATTTTAGATGATGTCTGGGAAGATAAGGACATCTCTAAGTGGGAAAATCTATTTTCATCTTTGAGAACAGGAGTGTGTGGAAGGAAGATTTTGTTGACAACCCGAATGCAATCAGTTGCAGATTTAGCATCAGCGGTAATGAGATGTGAAAGGGAGTTCTTCCCATTATGTGGACTTGAAGAAGATGAAAATTTAAGACTTTTTAATCATCATGCCTTCATTAATCCAGATCCCCAAGAATTTGAAGACTTCCAACAAGTTGGAGAAGAAATCGCAAAGAAACTAAGAGGGTGTCCCTTGGTAACTAAGGTTGTCGCTGGGCATCTACGGGCACACATGAAAGTTCAATTTTGGAATACATTTTTGCATGAACATCTGGATAATTTTGATGGAAGTATGGAAGATGTTGTCAAAGTTCTCAAGTTAAGTTACTACCATTTGGTACCTGGCCTACAAGTGTGCTTCCGATATTGTAGCATATTCCCAAAAAACCATGAATTCAAAAAAGAAGAATTGGTGAAGATGTGGATAGCTGCAGGATTGATCTCCCAGACCACAGGTGAAGCAGAGAGAGCACAGGATGCTGCAGAAGAGTACTTGGATCTGCTGAATAGAAAGTCCTTCTTTGAACTCAAGTTGAGAAACTTCCGTTTCGGAAGGAACGAATGCCATGAATATTTTGTGATGCATGACTTAATGCATGATTTGGCAACATGGGTTTCTTCAGGTGAATGTGCAAGAATTGCTGATGTTGCTAGCTCCAAGAAGCTGAAACCAACAGTACGCCACCTATCTGTTGCTGGTATTGATGGTTTTCCAGTCGACGCCATCAAAAGTTTGTCCCAGTTCAAAAATCTGCGCACCATTATCATTGAAGATTGCCATGATATCCAGGATGACACTTCACGGGAAGTGGAGAAAGTTATAGAAAGCTTAAAAGCCCTGCGTGTCGTGCAATACCACATGTTCAGTAGATCCCGATTCCCTGGAAAAGAAGCTAATCTAAAGCACCTTCGTTATGTAAGTGTCTCAATGAATTAG


Protein sequences

Name Description Sequence
hypothetical protein Os12g0204800 [Oryza sativa (japonica cultivar-group)].

METAVLVFAGKSLATPAISFFVNKAFSYLNEYRKAEGLEAVKNRLEENIPKIQSVIDVADPDYIKDKSEALDAWLWQLRDAVEEAEDAIDELEVERDQNKVSHQAGSSSFTRMKHKFVQSVKHVRVLGTTSNSPLKRLKKALEGLDEAAKGVKNFLTLVQIHQNTRSNLNNPEQDDISFRAKGKDLNADRVFGRENEKEHIVGWLTNTSSEDNQDAKNNNHVPIMSIVGHGGIGKTTLAQLISHDSRIKKHFDTVIWVAVSMSFDAKTLLDKIIQSVTLLKPSVDTYEALQQHLKKEIETIKYLLILDDVWEDKDISKWENLFSSLRTGVCGRKILLTTRMQSVADLASAVMRCEREFFPLCGLEEDENLRLFNHHAFINPDPQEFEDFQQVGEEIAKKLRGCPLVTKVVAGHLRAHMKVQFWNTFLHEHLDNFDGSMEDVVKVLKLSYYHLVPGLQVCFRYCSIFPKNHEFKKEELVKMWIAAGLISQTTGEAERAQDAAEEYLDLLNRKSFFELKLRNFRFGRNECHEYFVMHDLMHDLATWVSSGECARIADVASSKKLKPTVRHLSVAGIDGFPVDAIKSLSQFKNLRTIIIEDCHDIQDDTSREVEKVIESLKALRVVQYHMFSRSRFPGKEANLKHLRYVSVSMN

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017:SF28
50-550 PTHR11017:SF28

PKIQSVIDVADPDYIKDKSEALDAWLWQLRDAVEEAEDAIDELEVERDQNKVSHQAGSSSFTRMKHKFVQSVKHVRVLGTTSNSPLKRLKKALEGLDEAAKGVKNFLTLVQIHQNTRSNLNNPEQDDISFRAKGKDLNADRVFGRENEKEHIVGWLTNTSSEDNQDAKNNNHVPIMSIVGHGGIGKTTLAQLISHDSRIKKHFDTVIWVAVSMSFDAKTLLDKIIQSVTLLKPSVDTYEALQQHLKKEIETIKYLLILDDVWEDKDISKWENLFSSLRTGVCGRKILLTTRMQSVADLASAVMRCEREFFPLCGLEEDENLRLFNHHAFINPDPQEFEDFQQVGEEIAKKLRGCPLVTKVVAGHLRAHMKVQFWNTFLHEHLDNFDGSMEDVVKVLKLSYYHLVPGLQVCFRYCSIFPKNHEFKKEELVKMWIAAGLISQTTGEAERAQDAAEEYLDLLNRKSFFELKLRNFRFGRNECHEYFVMHDLMHDLATWVSSGEC

HMMPanther: PTHR11017
50-550 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

PKIQSVIDVADPDYIKDKSEALDAWLWQLRDAVEEAEDAIDELEVERDQNKVSHQAGSSSFTRMKHKFVQSVKHVRVLGTTSNSPLKRLKKALEGLDEAAKGVKNFLTLVQIHQNTRSNLNNPEQDDISFRAKGKDLNADRVFGRENEKEHIVGWLTNTSSEDNQDAKNNNHVPIMSIVGHGGIGKTTLAQLISHDSRIKKHFDTVIWVAVSMSFDAKTLLDKIIQSVTLLKPSVDTYEALQQHLKKEIETIKYLLILDDVWEDKDISKWENLFSSLRTGVCGRKILLTTRMQSVADLASAVMRCEREFFPLCGLEEDENLRLFNHHAFINPDPQEFEDFQQVGEEIAKKLRGCPLVTKVVAGHLRAHMKVQFWNTFLHEHLDNFDGSMEDVVKVLKLSYYHLVPGLQVCFRYCSIFPKNHEFKKEELVKMWIAAGLISQTTGEAERAQDAAEEYLDLLNRKSFFELKLRNFRFGRNECHEYFVMHDLMHDLATWVSSGEC

superfamily: SSF52540
174-438 SSF52540

QDDISFRAKGKDLNADRVFGRENEKEHIVGWLTNTSSEDNQDAKNNNHVPIMSIVGHGGIGKTTLAQLISHDSRIKKHFDTVIWVAVSMSFDAKTLLDKIIQSVTLLKPSVDTYEALQQHLKKEIETIKYLLILDDVWEDKDISKWENLFSSLRTGVCGRKILLTTRMQSVADLASAVMRCEREFFPLCGLEEDENLRLFNHHAFINPDPQEFEDFQQVGEEIAKKLRGCPLVTKVVAGHLRAHMKVQFWNTFLHEHLDNFDGSM

Gene3D: G3DSA:3.40.50.300
188-236 G3DSA:3.40.50.300

ADRVFGRENEKEHIVGWLTNTSSEDNQDAKNNNHVPIMSIVGHGGIGKT

HMMPfam: PF00931
IPR002182
218-489 NB-ARC,NBS
NB-ARC

NNNHVPIMSIVGHGGIGKTTLAQLISHDSRIKKHFDTVIWVAVSMSFDAKTLLDKIIQSVTLLKPSVDTYEALQQHLKKEIETIKYLLILDDVWEDKDISKWENLFSSLRTGVCGRKILLTTRMQSVADLASAVMRCEREFFPLCGLEEDENLRLFNHHAFINPDPQEFEDFQQVGEEIAKKLRGCPLVTKVVAGHLRAHMKVQFWNTFLHEHLDNFDGSMEDVVKVLKLSYYHLVPGLQVCFRYCSIFPKNHEFKKEELVKMWIAAGLISQ

FPrintScan: PR00364
IPR000767
224-239 DISEASERSIST
Disease resistance protein

IMSIVGHGGIGKTTLA

Gene3D: G3DSA:3.40.50.300
237-311 G3DSA:3.40.50.300

TLAQLISHDSRIKKHFDTVIWVAVSMSFDAKTLLDKIIQSVTLLKPSVDTYEALQQHLKKEIETIKYLLILDDVW

FPrintScan: PR00364
IPR000767
297-311 DISEASERSIST
Disease resistance protein

EIETIKYLLILDDVW

FPrintScan: PR00364
IPR000767
400-414 DISEASERSIST
Disease resistance protein

LRGCPLVTKVVAGHL

superfamily: SSF52058
533-651 SSF52058,LRR

VMHDLMHDLATWVSSGECARIADVASSKKLKPTVRHLSVAGIDGFPVDAIKSLSQFKNLRTIIIEDCHDIQDDTSREVEKVIESLKALRVVQYHMFSRSRFPGKEANLKHLRYVSVSMN

Gene3D: G3DSA:3.80.10.10
549-649 G3DSA:3.80.10.10

ECARIADVASSKKLKPTVRHLSVAGIDGFPVDAIKSLSQFKNLRTIIIEDCHDIQDDTSREVEKVIESLKALRVVQYHMFSRSRFPGKEANLKHLRYVSVS

FPrintScan: PR00364
IPR000767
586-602 DISEASERSIST
Disease resistance protein

SQFKNLRTIIIEDCHDI


List of References




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox