PRGDB00049867 (Os12g0204600)

From PRG Wiki
Jump to: navigation, search
Os12g0204600
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 115487783 (NM_001072911)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa (japonica cultivar-group) Os12g0204600 (Os12g0204600) mRNA, complete cds.

DNA Sequence

ATGGATTTGGTGTTTGCAGGGCAGTCGGCGACAGATGAAGTCATCGCTAACCTGATCGACAAGGCCTCATCCTACCTGGGAAGCAACCCCGACAGATTGCAGGAGTCGATGCGCATGCTACGCCTGAAGTTGCCGAAGATGCGCGATACCCTCATACCGGCTCAATCCAGGGAGTCGTACTCAGGACTTGGGGTTTTGCTGGACGAGTCGTTGTGGCGCCTGAGGGATGCAGTTGAGGAGCTCGAGGATGCAGTCGACGAGCATGCCTACCACGAGAAGAAGACCAAGGAGCGAGAGGTTAGTGATGGTGATCTGGGCTCTTCTTTCTCCAAGATGAAGCAACGAGTTATCAAGTCTTTGGCAAATGGTCGCACTCTCGAAAGGAGGTTGAGGAAAGCTATCGAGGCTTTAGACATGGTTATTGTGGATATTGCAAAGAGACTACCATCTGATGTTAGACTTACACAAGAGCAATTGGATCAACATCGTTTACAACTATATCGCAGGACGGTTGACTTTACACAACGATATTTCATGACGGCTGGCTTTAAGGATAGAGTGTTGGGCCGGGAGAAGGAGACTGATGTGATAGTCCGATGGCTGATCGATCCCTTGGATGATGATGATGCTGAAACTCAGGTTAGTCCAAATAATCATCATGTCTCAGTTATGTCCATAGTTGGCCACGGTGGCGTGGGGAAGACTACATTGGCACAACTGGTATATAATGATCCAAGGGTCAGAGATCATTTTGATATGGTTGCATGGTTATGTGTAACTTCAAGCTTTGATGTAGGAAGAATTATGCGTGAAATAGTACAGTGTGTTACACGTTCGCCATGTTCATCCGATTCTTTGGAAAACATGCAGCATATTCTCCAAGATAAAATAAATTCCACTAAAGCTTTTCTACTCGTTTTGGATGATGTCTGGGAAGAAAATCTACATGAATGGGAGAAACTATTTTCAGTTCTGAGGGGCATCAACACTAGAATCAAAATTTTATTGACAACCAGAACGCAATCAGTGGCAACTCTAGTTGAGAGTGTCACAGGATGTGAAGATCAGCACCTTAGGTTGCATGAACTTGAAGAAAATGGAAATCTACAGATCTTCTGCCAACTTGCTTTGGCTGATCTGAATGAAAGATCAGAAGATTATGCGGAACTCCAATCAATCGGCGCTAAGATTGTAAAGAAACTTGGAGGGACTCCCGCGGCAATAAAAAGTGCTGCTTATCTGTTACGAGTAAGATCATTAGAGTCCTGGCGAAGGTTTCTTCACGGTATGGATAATTTTGGAGCAGCAGTACCAAATATTATGGATGTCTTGAAAATAAGCTACTACAGGCTCTCGGCAGAGTTGCAGAGTTGCTTTCGCTATTGCAGCTTATTTCCAAAAAATCATCCATTCAGAAAGGAGGAGTTGGTGAGGGCTTGGATTTGGTCAGGATTGATATTTCCTCAATTCGGGAAAAAGGACGGAGAGTTATACTTGGCTCAATTGACTGCAAATTTGTTCCTTGATCGCTTTGGTGGAGAAAACGAAGAACCTGCATACTATGTTATGAATGACACAATGCATGATTTTGCAACATATATCTCACAGGGCGAATGTAAGAGGTTAACTGAAGCCGCAGACTTGAGAAACGTGAAGAGTTCGGTTCGACACATTAGTATTGCAGGTATTAACAATTTCACTGTTGTTGATGTGAAGGAATTGCTCCGTTTGACGAAGCTGCGCACAGTCATCATTGAAGATTGTGGCAATGTCGAGGAGGACGTGGTATACGCAATGGCAGAGGTCGTGAAGAACTCAAAATCCTTGCGTCTGTTAGAATGTTCTCTGTTCAAGATGTGCCATTTACCTGACAGACTTTCTAGTCTGATGCACCTTCGTCACGTCAAGATCTCAATGCTTTAA


Protein sequences

Name Description Sequence
hypothetical protein Os12g0204600 [Oryza sativa (japonica cultivar-group)].

MDLVFAGQSATDEVIANLIDKASSYLGSNPDRLQESMRMLRLKLPKMRDTLIPAQSRESYSGLGVLLDESLWRLRDAVEELEDAVDEHAYHEKKTKEREVSDGDLGSSFSKMKQRVIKSLANGRTLERRLRKAIEALDMVIVDIAKRLPSDVRLTQEQLDQHRLQLYRRTVDFTQRYFMTAGFKDRVLGREKETDVIVRWLIDPLDDDDAETQVSPNNHHVSVMSIVGHGGVGKTTLAQLVYNDPRVRDHFDMVAWLCVTSSFDVGRIMREIVQCVTRSPCSSDSLENMQHILQDKINSTKAFLLVLDDVWEENLHEWEKLFSVLRGINTRIKILLTTRTQSVATLVESVTGCEDQHLRLHELEENGNLQIFCQLALADLNERSEDYAELQSIGAKIVKKLGGTPAAIKSAAYLLRVRSLESWRRFLHGMDNFGAAVPNIMDVLKISYYRLSAELQSCFRYCSLFPKNHPFRKEELVRAWIWSGLIFPQFGKKDGELYLAQLTANLFLDRFGGENEEPAYYVMNDTMHDFATYISQGECKRLTEAADLRNVKSSVRHISIAGINNFTVVDVKELLRLTKLRTVIIEDCGNVEEDVVYAMAEVVKNSKSLRLLECSLFKMCHLPDRLSSLMHLRHVKISML

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017:SF28
49-560 PTHR11017:SF28

DTLIPAQSRESYSGLGVLLDESLWRLRDAVEELEDAVDEHAYHEKKTKEREVSDGDLGSSFSKMKQRVIKSLANGRTLERRLRKAIEALDMVIVDIAKRLPSDVRLTQEQLDQHRLQLYRRTVDFTQRYFMTAGFKDRVLGREKETDVIVRWLIDPLDDDDAETQVSPNNHHVSVMSIVGHGGVGKTTLAQLVYNDPRVRDHFDMVAWLCVTSSFDVGRIMREIVQCVTRSPCSSDSLENMQHILQDKINSTKAFLLVLDDVWEENLHEWEKLFSVLRGINTRIKILLTTRTQSVATLVESVTGCEDQHLRLHELEENGNLQIFCQLALADLNERSEDYAELQSIGAKIVKKLGGTPAAIKSAAYLLRVRSLESWRRFLHGMDNFGAAVPNIMDVLKISYYRLSAELQSCFRYCSLFPKNHPFRKEELVRAWIWSGLIFPQFGKKDGELYLAQLTANLFLDRFGGENEEPAYYVMNDTMHDFATYISQGECKRLTEAADLRNVKSSVRHISI

HMMPanther: PTHR11017
49-560 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

DTLIPAQSRESYSGLGVLLDESLWRLRDAVEELEDAVDEHAYHEKKTKEREVSDGDLGSSFSKMKQRVIKSLANGRTLERRLRKAIEALDMVIVDIAKRLPSDVRLTQEQLDQHRLQLYRRTVDFTQRYFMTAGFKDRVLGREKETDVIVRWLIDPLDDDDAETQVSPNNHHVSVMSIVGHGGVGKTTLAQLVYNDPRVRDHFDMVAWLCVTSSFDVGRIMREIVQCVTRSPCSSDSLENMQHILQDKINSTKAFLLVLDDVWEENLHEWEKLFSVLRGINTRIKILLTTRTQSVATLVESVTGCEDQHLRLHELEENGNLQIFCQLALADLNERSEDYAELQSIGAKIVKKLGGTPAAIKSAAYLLRVRSLESWRRFLHGMDNFGAAVPNIMDVLKISYYRLSAELQSCFRYCSLFPKNHPFRKEELVRAWIWSGLIFPQFGKKDGELYLAQLTANLFLDRFGGENEEPAYYVMNDTMHDFATYISQGECKRLTEAADLRNVKSSVRHISI

superfamily: SSF52540
165-430 SSF52540

QLYRRTVDFTQRYFMTAGFKDRVLGREKETDVIVRWLIDPLDDDDAETQVSPNNHHVSVMSIVGHGGVGKTTLAQLVYNDPRVRDHFDMVAWLCVTSSFDVGRIMREIVQCVTRSPCSSDSLENMQHILQDKINSTKAFLLVLDDVWEENLHEWEKLFSVLRGINTRIKILLTTRTQSVATLVESVTGCEDQHLRLHELEENGNLQIFCQLALADLNERSEDYAELQSIGAKIVKKLGGTPAAIKSAAYLLRVRSLESWRRFLHGM

Gene3D: G3DSA:3.40.50.300
189-342 G3DSA:3.40.50.300

GREKETDVIVRWLIDPLDDDDAETQVSPNNHHVSVMSIVGHGGVGKTTLAQLVYNDPRVRDHFDMVAWLCVTSSFDVGRIMREIVQCVTRSPCSSDSLENMQHILQDKINSTKAFLLVLDDVWEENLHEWEKLFSVLRGINTRIKILLTTRTQS

HMMPfam: PF00931
IPR002182
218-486 NB-ARC,NBS
NB-ARC

NHHVSVMSIVGHGGVGKTTLAQLVYNDPRVRDHFDMVAWLCVTSSFDVGRIMREIVQCVTRSPCSSDSLENMQHILQDKINSTKAFLLVLDDVWEENLHEWEKLFSVLRGINTRIKILLTTRTQSVATLVESVTGCEDQHLRLHELEENGNLQIFCQLALADLNERSEDYAELQSIGAKIVKKLGGTPAAIKSAAYLLRVRSLESWRRFLHGMDNFGAAVPNIMDVLKISYYRLSAELQSCFRYCSLFPKNHPFRKEELVRAWIWSGLI

FPrintScan: PR00364
IPR000767
223-238 DISEASERSIST
Disease resistance protein

VMSIVGHGGVGKTTLA

FPrintScan: PR00364
IPR000767
297-311 DISEASERSIST
Disease resistance protein

INSTKAFLLVLDDVW

FPrintScan: PR00364
IPR000767
401-415 DISEASERSIST
Disease resistance protein

LGGTPAAIKSAAYLL

superfamily: SSF52058
522-638 SSF52058,LRR

VMNDTMHDFATYISQGECKRLTEAADLRNVKSSVRHISIAGINNFTVVDVKELLRLTKLRTVIIEDCGNVEEDVVYAMAEVVKNSKSLRLLECSLFKMCHLPDRLSSLMHLRHVKIS

Gene3D: G3DSA:3.80.10.10
553-638 G3DSA:3.80.10.10

SSVRHISIAGINNFTVVDVKELLRLTKLRTVIIEDCGNVEEDVVYAMAEVVKNSKSLRLLECSLFKMCHLPDRLSSLMHLRHVKIS

FPrintScan: PR00364
IPR000767
575-591 DISEASERSIST
Disease resistance protein

LRLTKLRTVIIEDCGNV


List of References




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox