PRGDB00049868 (Os12g0202900)

From PRG Wiki
Jump to: navigation, search
Os12g0202900
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 115487771 (NM_001072905)
Gene Class NL
Domain Type LRR, NBS, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa (japonica cultivar-group) Os12g0202900 (Os12g0202900) mRNA, complete cds.

DNA Sequence

ATGCCCGCCCTGCGAAGATCTTTCTCTATAGCTTCTGTTATGGCACTAGTGTTTGCTGGAAAGGCAGTGGCAACTGCAGCCATCTCCTTCTGGATCAACAAGGCTTTCACCTACCTGAAAGAGTACAAGGTTGAAGGCATCGAAGATATTAAGAACAGGCTACTGCAGTCGATGCCGAAGATCCAGGTCGTTCTCGATATTGTCAATCCCAGGTATGTAAAGGAACAGAGCAGTGCACTAGATGCATGGTTATGGCAGCTCAGGCACGCAGTTGAGGAGGCTGAGGACGTGATCGATGTGCTCGAGTACTACAAACTCAAAGAAATGGCAAAGGACCACAAGGTTAGTGTCTGGGGTTCCTCTTTCTCTAAGGTGAAGCACAAAGTTATTAAGTCTGTTAAACATGTCAGTATTTTGGACAAGAATTTGAAACAATTTACTCACCGGGGCACTCTCAAGAGGTTGAGGGAAGCTGTGGAGGGTTTAGACAAGGTTGCTTCAGATATTATGAGCATTCTCACAGTCACAGAACATCTCAAAGAGGTTGCTTCGTGTAGTCAGCAGCAGGAGTATTCAACGAACGATGATCGTGCGACAGGTTTGACATTAACTCCACCTAAATTTGTTGGACGAGAAAAGGAGAAAGAAAAGATAGTTAGATGGCTGACAAAGGCATCAACTGACGCTTCTGGAAATTTGATGAGCACTAACCATATTCCTATTCTGTCGTTAATTGGTCACGGTGGCATGGGGAAGACTACGTTGGCTCAACGTGTTTGTGAAGAAATGGTTAGGAAGAATTTCAAGGTTATATGGGTGTGTGTATCTGATCGCTTTGATGTAACATCTGTGACAAGTAAAATACTAGAATCTGCTACGGGGGCAAAACCTAATGCTAATTGTTTGGAGACACTACAGCAAAGCCTAATACACAAACTGAAGTATTCTACTGATTTTTTGCTTGTTTTAGATGATGTGTGGGAAGATAAGAAAATAGATAAATGGGAAAAGTTGTTTGCTCCTCTAAGGACAGGGAAGAGTGGGAGCAAAATTTTGTTAACAACACGGATGCAGTCAGTAGCTGTTTTGGCCACAGAAGCCATGGGAATTGAAACAGAGTTCTTGTCAATAGAAGGACTAGAAGAAGGTGAAAATCTTGAGCTCTTCAGTCATTCTGTATTTTCTGGTCAGAATCCACAAGATTTTCCAAATTTGAAATCAGTCGGCAAACAAATTGTGAAGAAACTAGGAGGATGTCCCCTGGTAACAAAGGTTGTCGGTGGCCATTTGCGGAGCAATATGAGTTTTCAACACTGGAACAATTTCTTGCAAGAAGGTTTGCAACATTTTAAAGGAAGTGAAGATGATATTATGGAAGTCCTCAGACTAAGCTACTACTGTCTACCAACCGACCTTCAGATTTGCTTTCGATACTGTAGTATATTCCCGCAAGATTATGCATTTAAAATGAAAGACCTAGTGCTGATGTGGATAGGTTCAGGACTGATCTCAGAAGCTGGAAATAAACCACCAAAAAGGCTTGAGGACATTGGAGAACAGATCTTGGCTCAATTAGCTGGGAAATCATTCTTTGAAACCAATATCAAAGTAGATCCGTATAGTCAAAGGAAAGAAAATTATTACATAATGCATGACTTAATGCATGAATTGGCAAGGTATGTATCTTCTGGGGAATGTGCAAGAATAATCAGTCCTGGCATGTTGGAAAATGAGAAGGATACAGTTCGACACCTATGTATTTCAGGAATTGACCATTTATCTACTGAGGAGGTTAAGAAGATCTTACATTTTAAGAATGTGCGCACTGTTATCATTGAAGGCTCAGGTTTGATTGACAGCAATTTATTTCATGCAGTTGAAAATGTTATGGAACAATCAAAATCGCTGCGTCTACTGCAATCAAATTTGGAGAATACATTTCATCTTCCAAAAATTGCTCATCTAAAGCACCTCTGTTATATTGATCTACCTAGGATATCTCCTGATACCATATGTGGACTTGTGAAACTTTATCACTTATTGCTAGTTAAATGTTTCAATGGTTCTCGCGAAGAGCCAAAACAAGTGAGGTATTTGGGAAACATTGATCATCTGCGATATGTGAATTACGGCAAAATTGGTGAGTTCCCAATTGGAAGGCTCACTTCACTTCAGGAGCTGCACAACTACAGGATCCAAGGTGGCAAAGGTAACAAAATAAGCGCAATCAGCAACTTGAGTACTCTTCGTGAACTAGAGGTGCTTGGTCTTGAGAATGTTGAGAGCCATGAAGAAGCTGACAATGTCGAGCTAAATGATAAGAAATATATCACCTTGTTATCTTTGGCATGGTCAGCACGTGCGGCTGTGGAAAACAGAAAAGATGAGTTGCTTCTTAATCACCTTGAGCCATATGCTAATATTGAAACACTGAGAATTTCAGGTTATGGTGGTGTAAGGTCTCCTATTTGGATTGAAAATCTCTGCATCAAGAACTTAGTGTCACTCGAGTTGGCAAGATGTCTATATTGGGAAAAACTTCCTTCACTTGGAGAGTTAGTATCTCTTAAACATCTTTGGTTGGAGTGCCTTCCTAGTTTGCAACAGATTGGTCAATCATCTGAGGCCTCAAGTAGTAATTGTGTTGATTTATCCCTTCCTCCAAATCTTGACACTATGATAGTAAGACGCTGCAAAGAGCTGAGGGCATTGCCTATCCTGCCTACTACCTTGGTTCATTTTGAAACAAGTAATGTTGGTTTGACCAAACTTCCTAGGATAGGAAAGGAATGCAACGAGAACCTCGAGACCAAGTCATCCAGGCTGCTGGTCGTAGTTGTCGAAGAATGTAAATGTCTGAACTCACTTGAAGAGAGCCTTCTAGTGCAGGGAGACTACATCAAAAGCATCCATGTCCTACGCATCTCAGATTGTGAAGATCTGGAGGCTGCTCCATTGGTATTTGAACAGATGAATGAACTTAGAGAGCTTGATATCAGAAACTGTCCAAAGCTGAGGACATCGAGAGGTGTTGGAGATACATTCCTGCCATTAGCACTTCAAAAACTGAATGTCAATTACTGTGGTGAACTTGAACTTCCACTGATTGGAGCACTACAAGGACTCACGCATCTTTCTGAGCTGGTGTTGGAGAAGTGCAAATACCTAGAATCACTCCCCTCACATGATGTGTTCAAGAGCCTCAAGTCTCTGAAGTCTCTCGAGATAATAGGATGCGAGAATCTGTCATCCTTAGGTGGTCTTGGTTCGCTTCAATACCTTCTTGAGCTGAAAATCAGTGCTTGTAGTAAGCTCATGGCGATCGGGTCATCCCAAACTCCCGACGCATCGTCTACTAGCACCCTGCAGATAGACTATATTGAAATTGATCTGCCAGACATACTGCATCTTGAGCCACTCAAGGGTCTCTGTCACACCAAGGGGTTGGTGATCAGAGGTGGAACGCAGCTGGAGAGCTTACCTGAGGAATGGCTTCTTCAGAATCGTGGAAAGCTCCAATCCCTGAAGATTTACAGTGCCAGTTCTTTGGAATCTCTGCCCCTCCATATGCGAGACCTATGCTCTCTCAACTTATTGCTGTTATCTGGTGCTAGGAAGCTTCAGTCGCTTCCTGATTTCCCATCCTCTCTGCAGAAGCTCGATATCACTTGCTGCTGCAAAGAACTGGAGGAGAAGGTTGGAGTATATGAAAGCCCTGAATGGAATAATATCTCCCATATTGCCAGGGTGCACATAGGTACTGCCTTCTCTGACCTCCTTGTTCTTATTTTGTCATGTAAGGAGATTCATACTTCATGGACGGCAAAAAATGCAGTGAAGAGACTTTGGACAGACAGCAGTGATGAAATACTGGTTCAAGCATAA


Protein sequences

Name Description Sequence
hypothetical protein Os12g0202900 [Oryza sativa (japonica cultivar-group)].

MPALRRSFSIASVMALVFAGKAVATAAISFWINKAFTYLKEYKVEGIEDIKNRLLQSMPKIQVVLDIVNPRYVKEQSSALDAWLWQLRHAVEEAEDVIDVLEYYKLKEMAKDHKVSVWGSSFSKVKHKVIKSVKHVSILDKNLKQFTHRGTLKRLREAVEGLDKVASDIMSILTVTEHLKEVASCSQQQEYSTNDDRATGLTLTPPKFVGREKEKEKIVRWLTKASTDASGNLMSTNHIPILSLIGHGGMGKTTLAQRVCEEMVRKNFKVIWVCVSDRFDVTSVTSKILESATGAKPNANCLETLQQSLIHKLKYSTDFLLVLDDVWEDKKIDKWEKLFAPLRTGKSGSKILLTTRMQSVAVLATEAMGIETEFLSIEGLEEGENLELFSHSVFSGQNPQDFPNLKSVGKQIVKKLGGCPLVTKVVGGHLRSNMSFQHWNNFLQEGLQHFKGSEDDIMEVLRLSYYCLPTDLQICFRYCSIFPQDYAFKMKDLVLMWIGSGLISEAGNKPPKRLEDIGEQILAQLAGKSFFETNIKVDPYSQRKENYYIMHDLMHELARYVSSGECARIISPGMLENEKDTVRHLCISGIDHLSTEEVKKILHFKNVRTVIIEGSGLIDSNLFHAVENVMEQSKSLRLLQSNLENTFHLPKIAHLKHLCYIDLPRISPDTICGLVKLYHLLLVKCFNGSREEPKQVRYLGNIDHLRYVNYGKIGEFPIGRLTSLQELHNYRIQGGKGNKISAISNLSTLRELEVLGLENVESHEEADNVELNDKKYITLLSLAWSARAAVENRKDELLLNHLEPYANIETLRISGYGGVRSPIWIENLCIKNLVSLELARCLYWEKLPSLGELVSLKHLWLECLPSLQQIGQSSEASSSNCVDLSLPPNLDTMIVRRCKELRALPILPTTLVHFETSNVGLTKLPRIGKECNENLETKSSRLLVVVVEECKCLNSLEESLLVQGDYIKSIHVLRISDCEDLEAAPLVFEQMNELRELDIRNCPKLRTSRGVGDTFLPLALQKLNVNYCGELELPLIGALQGLTHLSELVLEKCKYLESLPSHDVFKSLKSLKSLEIIGCENLSSLGGLGSLQYLLELKISACSKLMAIGSSQTPDASSTSTLQIDYIEIDLPDILHLEPLKGLCHTKGLVIRGGTQLESLPEEWLLQNRGKLQSLKIYSASSLESLPLHMRDLCSLNLLLLSGARKLQSLPDFPSSLQKLDITCCCKELEEKVGVYESPEWNNISHIARVHIGTAFSDLLVLILSCKEIHTSWTAKNAVKRLWTDSSDEILVQA

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017
64-1134 FAMILY NOT NAMED,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

VLDIVNPRYVKEQSSALDAWLWQLRHAVEEAEDVIDVLEYYKLKEMAKDHKVSVWGSSFSKVKHKVIKSVKHVSILDKNLKQFTHRGTLKRLREAVEGLDKVASDIMSILTVTEHLKEVASCSQQQEYSTNDDRATGLTLTPPKFVGREKEKEKIVRWLTKASTDASGNLMSTNHIPILSLIGHGGMGKTTLAQRVCEEMVRKNFKVIWVCVSDRFDVTSVTSKILESATGAKPNANCLETLQQSLIHKLKYSTDFLLVLDDVWEDKKIDKWEKLFAPLRTGKSGSKILLTTRMQSVAVLATEAMGIETEFLSIEGLEEGENLELFSHSVFSGQNPQDFPNLKSVGKQIVKKLGGCPLVTKVVGGHLRSNMSFQHWNNFLQEGLQHFKGSEDDIMEVLRLSYYCLPTDLQICFRYCSIFPQDYAFKMKDLVLMWIGSGLISEAGNKPPKRLEDIGEQILAQLAGKSFFETNIKVDPYSQRKENYYIMHDLMHELARYVSSGECARIISPGMLENEKDTVRHLCISGIDHLSTEEVKKILHFKNVRTVIIEGSGLIDSNLFHAVENVMEQSKSLRLLQSNLENTFHLPKIAHLKHLCYIDLPRISPDTICGLVKLYHLLLVKCFNGSREEPKQVRYLGNIDHLRYVNYGKIGEFPIGRLTSLQELHNYRIQGGKGNKISAISNLSTLRELEVLGLENVESHEEADNVELNDKKYITLLSLAWSARAAVENRKDELLLNHLEPYANIETLRISGYGGVRSPIWIENLCIKNLVSLELARCLYWEKLPSLGELVSLKHLWLECLPSLQQIGQSSEASSSNCVDLSLPPNLDTMIVRRCKELRALPILPTTLVHFETSNVGLTKLPRIGKECNENLETKSSRLLVVVVEECKCLNSLEESLLVQGDYIKSIHVLRISDCEDLEAAPLVFEQMNELRELDIRNCPKLRTSRGVGDTFLPLALQKLNVNYCGELELPLIGALQGLTHLSELVLEKCKYLESLPSHDVFKSLKSLKSLEIIGCENLSSLGGLGSLQYLLELKISACSKLMAIGSSQTPDASSTSTLQIDYIEIDLPDI

HMMPanther: PTHR11017:SF28
64-1134 OS08G0296600 PROTEIN

VLDIVNPRYVKEQSSALDAWLWQLRHAVEEAEDVIDVLEYYKLKEMAKDHKVSVWGSSFSKVKHKVIKSVKHVSILDKNLKQFTHRGTLKRLREAVEGLDKVASDIMSILTVTEHLKEVASCSQQQEYSTNDDRATGLTLTPPKFVGREKEKEKIVRWLTKASTDASGNLMSTNHIPILSLIGHGGMGKTTLAQRVCEEMVRKNFKVIWVCVSDRFDVTSVTSKILESATGAKPNANCLETLQQSLIHKLKYSTDFLLVLDDVWEDKKIDKWEKLFAPLRTGKSGSKILLTTRMQSVAVLATEAMGIETEFLSIEGLEEGENLELFSHSVFSGQNPQDFPNLKSVGKQIVKKLGGCPLVTKVVGGHLRSNMSFQHWNNFLQEGLQHFKGSEDDIMEVLRLSYYCLPTDLQICFRYCSIFPQDYAFKMKDLVLMWIGSGLISEAGNKPPKRLEDIGEQILAQLAGKSFFETNIKVDPYSQRKENYYIMHDLMHELARYVSSGECARIISPGMLENEKDTVRHLCISGIDHLSTEEVKKILHFKNVRTVIIEGSGLIDSNLFHAVENVMEQSKSLRLLQSNLENTFHLPKIAHLKHLCYIDLPRISPDTICGLVKLYHLLLVKCFNGSREEPKQVRYLGNIDHLRYVNYGKIGEFPIGRLTSLQELHNYRIQGGKGNKISAISNLSTLRELEVLGLENVESHEEADNVELNDKKYITLLSLAWSARAAVENRKDELLLNHLEPYANIETLRISGYGGVRSPIWIENLCIKNLVSLELARCLYWEKLPSLGELVSLKHLWLECLPSLQQIGQSSEASSSNCVDLSLPPNLDTMIVRRCKELRALPILPTTLVHFETSNVGLTKLPRIGKECNENLETKSSRLLVVVVEECKCLNSLEESLLVQGDYIKSIHVLRISDCEDLEAAPLVFEQMNELRELDIRNCPKLRTSRGVGDTFLPLALQKLNVNYCGELELPLIGALQGLTHLSELVLEKCKYLESLPSHDVFKSLKSLKSLEIIGCENLSSLGGLGSLQYLLELKISACSKLMAIGSSQTPDASSTSTLQIDYIEIDLPDI

Seg: seg
120-138 seg

SSFSKVKHKVIKSVKHVSI

superfamily: SSF52540
191-452 P-loop containing nucleoside triphosphate hydrolases

YSTNDDRATGLTLTPPKFVGREKEKEKIVRWLTKASTDASGNLMSTNHIPILSLIGHGGMGKTTLAQRVCEEMVRKNFKVIWVCVSDRFDVTSVTSKILESATGAKPNANCLETLQQSLIHKLKYSTDFLLVLDDVWEDKKIDKWEKLFAPLRTGKSGSKILLTTRMQSVAVLATEAMGIETEFLSIEGLEEGENLELFSHSVFSGQNPQDFPNLKSVGKQIVKKLGGCPLVTKVVGGHLRSNMSFQHWNNFLQEGLQHFKG

Gene3D: G3DSA:3.40.50.300
209-356 no description

VGREKEKEKIVRWLTKASTDASGNLMSTNHIPILSLIGHGGMGKTTLAQRVCEEMVRKNFKVIWVCVSDRFDVTSVTSKILESATGAKPNANCLETLQQSLIHKLKYSTDFLLVLDDVWEDKKIDKWEKLFAPLRTGKSGSKILLTTR

HMMPfam: PF00931
IPR002182
230-504 NB-ARC,NBS
NB-ARC

SGNLMSTNHIPILSLIGHGGMGKTTLAQRVCEEMVRKNFKVIWVCVSDRFDVTSVTSKILESATGAKPNANCLETLQQSLIHKLKYSTDFLLVLDDVWEDKKIDKWEKLFAPLRTGKSGSKILLTTRMQSVAVLATEAMGIETEFLSIEGLEEGENLELFSHSVFSGQNPQDFPNLKSVGKQIVKKLGGCPLVTKVVGGHLRSNMSFQHWNNFLQEGLQHFKGSEDDIMEVLRLSYYCLPTDLQICFRYCSIFPQDYAFKMKDLVLMWIGSGLIS

FPrintScan: PR00364
IPR000767
241-256 DISEASERSIST
Disease resistance protein

ILSLIGHGGMGKTTLA

FPrintScan: PR00364
IPR000767
313-327 DISEASERSIST
Disease resistance protein

LKYSTDFLLVLDDVW

Seg: seg
378-388 seg

EGLEEGENLEL

FPrintScan: PR00364
IPR000767
416-430 DISEASERSIST
Disease resistance protein

LGGCPLVTKVVGGHL

superfamily: SSF52058
549-1003 L domain-like,LRR

IMHDLMHELARYVSSGECARIISPGMLENEKDTVRHLCISGIDHLSTEEVKKILHFKNVRTVIIEGSGLIDSNLFHAVENVMEQSKSLRLLQSNLENTFHLPKIAHLKHLCYIDLPRISPDTICGLVKLYHLLLVKCFNGSREEPKQVRYLGNIDHLRYVNYGKIGEFPIGRLTSLQELHNYRIQGGKGNKISAISNLSTLRELEVLGLENVESHEEADNVELNDKKYITLLSLAWSARAAVENRKDELLLNHLEPYANIETLRISGYGGVRSPIWIENLCIKNLVSLELARCLYWEKLPSLGELVSLKHLWLECLPSLQQIGQSSEASSSNCVDLSLPPNLDTMIVRRCKELRALPILPTTLVHFETSNVGLTKLPRIGKECNENLETKSSRLLVVVVEECKCLNSLEESLLVQGDYIKSIHVLRISDCEDLEAAPLVFEQMNELRELDIRNCP

Gene3D: G3DSA:3.80.10.10
579-802 no description

KDTVRHLCISGIDHLSTEEVKKILHFKNVRTVIIEGSGLIDSNLFHAVENVMEQSKSLRLLQSNLENTFHLPKIAHLKHLCYIDLPRISPDTICGLVKLYHLLLVKCFNGSREEPKQVRYLGNIDHLRYVNYGKIGEFPIGRLTSLQELHNYRIQGGKGNKISAISNLSTLRELEVLGLENVESHEEADNVELNDKKYITLLSLAWSARAAVENRKDELLLNHL

Gene3D: G3DSA:3.80.10.10
803-992 no description

EPYANIETLRISGYGGVRSPIWIENLCIKNLVSLELARCLYWEKLPSLGELVSLKHLWLECLPSLQQIGQSSEASSSNCVDLSLPPNLDTMIVRRCKELRALPILPTTLVHFETSNVGLTKLPRIGKECNENLETKSSRLLVVVVEECKCLNSLEESLLVQGDYIKSIHVLRISDCEDLEAAPLVFEQMN

superfamily: SSF52058
940-1246 L domain-like,LRR

SRLLVVVVEECKCLNSLEESLLVQGDYIKSIHVLRISDCEDLEAAPLVFEQMNELRELDIRNCPKLRTSRGVGDTFLPLALQKLNVNYCGELELPLIGALQGLTHLSELVLEKCKYLESLPSHDVFKSLKSLKSLEIIGCENLSSLGGLGSLQYLLELKISACSKLMAIGSSQTPDASSTSTLQIDYIEIDLPDILHLEPLKGLCHTKGLVIRGGTQLESLPEEWLLQNRGKLQSLKIYSASSLESLPLHMRDLCSLNLLLLSGARKLQSLPDFPSSLQKLDITCCCKELEEKVGVYESPEWNNISH

Seg: seg
942-949 seg

LLVVVVEE

Gene3D: G3DSA:3.80.10.10
993-1113 no description

ELRELDIRNCPKLRTSRGVGDTFLPLALQKLNVNYCGELELPLIGALQGLTHLSELVLEKCKYLESLPSHDVFKSLKSLKSLEIIGCENLSSLGGLGSLQYLLELKISACSKLMAIGSSQT

FPrintScan: PR00364
IPR000767
1066-1082 DISEASERSIST
Disease resistance protein

KSLKSLKSLEIIGCENL

Seg: seg
1082-1097 seg

LSSLGGLGSLQYLLEL

Seg: seg
1193-1202 seg

LCSLNLLLLS


List of References




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox