PRGDB00049869 (Os12g0199100)

From PRG Wiki
Jump to: navigation, search
Os12g0199100
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 115487763 (NM_001072901)
Gene Class NL
Domain Type LRR, NBS, LRR, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa (japonica cultivar-group) Os12g0199100 (Os12g0199100) mRNA, complete cds.

DNA Sequence

ATGGCTGTGGTTCTGGAGGCCTTGGCATCCAACCTGAGCAATGTGCTTGCCAAGATGGCGAGGAAGGAGGTGGGCATGCTGCTTGGTATCTCTGACAAGATCGACAGCCTCCGCGTCAGGCTTGATGGGCTCAAGGAGTTCCTCGCCGACGCGGAGCGGAGGCGCATCACCGATCTGCACGTGCAGGGTTGGGTGAAGGAGCTCAAGGATGCCATGTACGATGCCACGGACATCCTGGAGCTGTGTCAGCTCAAAGCCATGGATCAGGACAGTAGGCGCAGCAACAACCCGTCGCTACTCTCCCTGCGGAATCCCTTGAACGCCCACCACATTGGAAGCCGCATCATGGCGCTGAACCAGCGGCTTGATGGCATCAAGCAGCGTGCCGAGCAATTCAGCTTCATCAAGCTCGATCGCTACGGTGACTGCAGCAGGACAGCTCAAGGCCATGGCTTACGCCGGACAACACCAGAGCTTGATCGGTCAGGCGTTGTCGGGAATAAGATCGAGCAAGATACAAGGAGACTGGTGGAGTTGCTAACGAGGGAGGAGGAAGAGGCAAGTGCGGCGAGTATCAGCAGCAACGTCAGGGTCGTTGCCATCGTCGGTGTTGGAGGTATTGGTAAAACTACCCTCGCACAGAACATCTTCAACCACCAGGACATCAAGGAGAAGTTCGACAAAATAATATGGCTGAGCATTAACCAGGAATTCAGTGATCCTGAGCTGGTGAGGACGGCCATCACTGGTGCCGGTGGTGAGCACAGTGGGCATCAAGAACTGTCCCTGCTTCAGCCAATCCTTCGAGAAGCAATATCTGGAAAGAAAATCTTTTTGGTGATGGATGATATGTGGAGCGTCCATGCTTGGAACAATTCATTAAGAATCCCTTTAGTTAACTCGGCTGCTCAAGGCAGCTGGGTTCTCATCACCACCAGAGACGAAAGAGTTGCCCGAGAGATGAAGGCCATACAGCCGTACCACCGCGTGGACATATTATCTCGGCAAGATGCCTGGTTGTTACTCAAGAAACAGATTGCTTCAACTTTGAAAGATGAGTATGCGATTGAGAAGCTAAAGAGTACTGGCTTTAGAATTTTAGAAAGATGTGGTGGTTTACCGCTAGCTATCAAAGCGATTGCAGGGCTTTTGAACCACAAAGAGATAAATGAAATTGAGTGGGGAAAGGTACTAAGAAGTCCTTCATGGTTAGTGGATGGAATGCCTGAAGAGATAAACCATGCAATATATTTAAGCTACGATGACCTAGACCCTCATTTGAAGCAATGCCTTTTGTATTGCTCACTCTTCCCTAAATATGGTAAACCCAATAAACATTTGATTGTTGAAGTATGGATTAGTGAAGGTTTTGTTAATGGAAAATCAAATGAACCGGAAGAACTAGGAAAGGAGTATTACAATGAGTTAATCATAAGGAACCTTTTACAGACAATGCCCGGCGACAATAATAATTGGACCATGCATGATGTGGTTCGCTCATTTTGTCGACATGTGGCTAAAGATGAAGCACTACCCTTTCATATGGAACATCTTAGAGTCACTGACCTCGATTCAAATAGATATCGTTGGTTGTGCATACAGAATGAATTAGATTGGAGTGCATGGCAAGAACAAAACTCAGTTAGAACGTTATTTTTTTATGGAAGTACTCATATCAAGTTGAAGGCCAATGATTTATGCAGCAAATTCTCAAACTTAAGGGTTCTGAGTATAGTATATGCACAACTTGCTACTTTTGATTCTCTATGCCAATTGAAGAACTTGAGGCACTTGTACTTTTCCCGTACTGACATACGTAGCCTGCCAGATGGCATCGGCAAGATGAAATTCTTGGAGTACATTGGGATTACATGCTGTGAACAAATACAACAACTTCCTGGTAGCATTATAAAACTAGAGCGGCTAAGATCTCTTAACCTTATGGGCACAAACATAAAAAGTATACCTAGGGGTTTTGGTCGCCTTACAAGTTTGAGAACATTATACTCGTTTCCAGCTCAGATGGGTAGCAGTTCATCAAAAGATGAGTGGTGTAGTTTGGAGGAGCTGGGACCTCTTTCTCAGCTCAGGGATCTCCATATAAAGGGTTTGGAGAATGTATCTGCCAGCTCTTCCGCTGCAAAGGCCATGCTTGGTGCCAAGAAACATCTTGCCATATGGTGGTTAGAGTGCACTGATAGGCAGAGAGATGATGGATTCTTGAAAGAGGAAGGAATCATTTCTATAGACGAGCAGCGACGAATCAAGGAGGTTTTTGATGAGTTGTGCCCTTCATACTGCTTAGAACAACTTTACATCAGAGGATATTTTGGTTGGCAGCTCCCAAAGTGGATGACATCAAAAGCATCTGTGAGGCTTGATAGATTGACGAGTCTTAAGTTGGATGGCCTGCCTTGCTGCACCAAACTCCCTGATGGCTTGTGTCAGCTTTCCTGTTTGAAGCTTCTACAGATCAGGCGTGCCCCAGCCATTGAGCGCATCGGGCATGAATTCCTGCAGATACAGCAACACAATGGTGATTGCCATCCTTCCCGAGCAGCGGTTGCATTTCCTATATTAGAGACGCTAGAGTTTACAGTAGTGCTGGAGTTGGAGGAATGGGTGTGGGAGGAACACATTCAAGCCATGCCACTCCTGCATGAGCTTACACTAGACAGGTGCAAATTGCGACAACTTCCTCTTGGACTTGCTGAGAACATGCCAGGGCTTTGA


Protein sequences

Name Description Sequence
hypothetical protein Os12g0199100 [Oryza sativa (japonica cultivar-group)].

MAVVLEALASNLSNVLAKMARKEVGMLLGISDKIDSLRVRLDGLKEFLADAERRRITDLHVQGWVKELKDAMYDATDILELCQLKAMDQDSRRSNNPSLLSLRNPLNAHHIGSRIMALNQRLDGIKQRAEQFSFIKLDRYGDCSRTAQGHGLRRTTPELDRSGVVGNKIEQDTRRLVELLTREEEEASAASISSNVRVVAIVGVGGIGKTTLAQNIFNHQDIKEKFDKIIWLSINQEFSDPELVRTAITGAGGEHSGHQELSLLQPILREAISGKKIFLVMDDMWSVHAWNNSLRIPLVNSAAQGSWVLITTRDERVAREMKAIQPYHRVDILSRQDAWLLLKKQIASTLKDEYAIEKLKSTGFRILERCGGLPLAIKAIAGLLNHKEINEIEWGKVLRSPSWLVDGMPEEINHAIYLSYDDLDPHLKQCLLYCSLFPKYGKPNKHLIVEVWISEGFVNGKSNEPEELGKEYYNELIIRNLLQTMPGDNNNWTMHDVVRSFCRHVAKDEALPFHMEHLRVTDLDSNRYRWLCIQNELDWSAWQEQNSVRTLFFYGSTHIKLKANDLCSKFSNLRVLSIVYAQLATFDSLCQLKNLRHLYFSRTDIRSLPDGIGKMKFLEYIGITCCEQIQQLPGSIIKLERLRSLNLMGTNIKSIPRGFGRLTSLRTLYSFPAQMGSSSSKDEWCSLEELGPLSQLRDLHIKGLENVSASSSAAKAMLGAKKHLAIWWLECTDRQRDDGFLKEEGIISIDEQRRIKEVFDELCPSYCLEQLYIRGYFGWQLPKWMTSKASVRLDRLTSLKLDGLPCCTKLPDGLCQLSCLKLLQIRRAPAIERIGHEFLQIQQHNGDCHPSRAAVAFPILETLEFTVVLELEEWVWEEHIQAMPLLHELTLDRCKLRQLPLGLAENMPGL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
5-904 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LEALASNLSNVLAKMARKEVGMLLGISDKIDSLRVRLDGLKEFLADAERRRITDLHVQGWVKELKDAMYDATDILELCQLKAMDQDSRRSNNPSLLSLRNPLNAHHIGSRIMALNQRLDGIKQRAEQFSFIKLDRYGDCSRTAQGHGLRRTTPELDRSGVVGNKIEQDTRRLVELLTREEEEASAASISSNVRVVAIVGVGGIGKTTLAQNIFNHQDIKEKFDKIIWLSINQEFSDPELVRTAITGAGGEHSGHQELSLLQPILREAISGKKIFLVMDDMWSVHAWNNSLRIPLVNSAAQGSWVLITTRDERVAREMKAIQPYHRVDILSRQDAWLLLKKQIASTLKDEYAIEKLKSTGFRILERCGGLPLAIKAIAGLLNHKEINEIEWGKVLRSPSWLVDGMPEEINHAIYLSYDDLDPHLKQCLLYCSLFPKYGKPNKHLIVEVWISEGFVNGKSNEPEELGKEYYNELIIRNLLQTMPGDNNNWTMHDVVRSFCRHVAKDEALPFHMEHLRVTDLDSNRYRWLCIQNELDWSAWQEQNSVRTLFFYGSTHIKLKANDLCSKFSNLRVLSIVYAQLATFDSLCQLKNLRHLYFSRTDIRSLPDGIGKMKFLEYIGITCCEQIQQLPGSIIKLERLRSLNLMGTNIKSIPRGFGRLTSLRTLYSFPAQMGSSSSKDEWCSLEELGPLSQLRDLHIKGLENVSASSSAAKAMLGAKKHLAIWWLECTDRQRDDGFLKEEGIISIDEQRRIKEVFDELCPSYCLEQLYIRGYFGWQLPKWMTSKASVRLDRLTSLKLDGLPCCTKLPDGLCQLSCLKLLQIRRAPAIERIGHEFLQIQQHNGDCHPSRAAVAFPILETLEFTVVLELEEWVWEEHIQAMPLLHELTLDRCKLRQLPLGLA

HMMPanther: PTHR23155:SF121
5-904 PTHR23155:SF121,SUBFAMILY NOT NAMED

LEALASNLSNVLAKMARKEVGMLLGISDKIDSLRVRLDGLKEFLADAERRRITDLHVQGWVKELKDAMYDATDILELCQLKAMDQDSRRSNNPSLLSLRNPLNAHHIGSRIMALNQRLDGIKQRAEQFSFIKLDRYGDCSRTAQGHGLRRTTPELDRSGVVGNKIEQDTRRLVELLTREEEEASAASISSNVRVVAIVGVGGIGKTTLAQNIFNHQDIKEKFDKIIWLSINQEFSDPELVRTAITGAGGEHSGHQELSLLQPILREAISGKKIFLVMDDMWSVHAWNNSLRIPLVNSAAQGSWVLITTRDERVAREMKAIQPYHRVDILSRQDAWLLLKKQIASTLKDEYAIEKLKSTGFRILERCGGLPLAIKAIAGLLNHKEINEIEWGKVLRSPSWLVDGMPEEINHAIYLSYDDLDPHLKQCLLYCSLFPKYGKPNKHLIVEVWISEGFVNGKSNEPEELGKEYYNELIIRNLLQTMPGDNNNWTMHDVVRSFCRHVAKDEALPFHMEHLRVTDLDSNRYRWLCIQNELDWSAWQEQNSVRTLFFYGSTHIKLKANDLCSKFSNLRVLSIVYAQLATFDSLCQLKNLRHLYFSRTDIRSLPDGIGKMKFLEYIGITCCEQIQQLPGSIIKLERLRSLNLMGTNIKSIPRGFGRLTSLRTLYSFPAQMGSSSSKDEWCSLEELGPLSQLRDLHIKGLENVSASSSAAKAMLGAKKHLAIWWLECTDRQRDDGFLKEEGIISIDEQRRIKEVFDELCPSYCLEQLYIRGYFGWQLPKWMTSKASVRLDRLTSLKLDGLPCCTKLPDGLCQLSCLKLLQIRRAPAIERIGHEFLQIQQHNGDCHPSRAAVAFPILETLEFTVVLELEEWVWEEHIQAMPLLHELTLDRCKLRQLPLGLA

superfamily: SSF52540
147-400 SSF52540

AQGHGLRRTTPELDRSGVVGNKIEQDTRRLVELLTREEEEASAASISSNVRVVAIVGVGGIGKTTLAQNIFNHQDIKEKFDKIIWLSINQEFSDPELVRTAITGAGGEHSGHQELSLLQPILREAISGKKIFLVMDDMWSVHAWNNSLRIPLVNSAAQGSWVLITTRDERVAREMKAIQPYHRVDILSRQDAWLLLKKQIASTLKDEYAIEKLKSTGFRILERCGGLPLAIKAIAGLLNHKEINEIEWGKVLRS

Gene3D: G3DSA:3.40.50.300
166-209 G3DSA:3.40.50.300

GNKIEQDTRRLVELLTREEEEASAASISSNVRVVAIVGVGGIGK

HMMPfam: PF00931
IPR002182
193-459 NB-ARC,NBS
NB-ARC

SSNVRVVAIVGVGGIGKTTLAQNIFNHQDIKEKFDKIIWLSINQEFSDPELVRTAITGAGGEHSGHQELSLLQPILREAISGKKIFLVMDDMWSVHAWNNSLRIPLVNSAAQGSWVLITTRDERVAREMKAIQPYHRVDILSRQDAWLLLKKQIASTLKDEYAIEKLKSTGFRILERCGGLPLAIKAIAGLLNHKEINEIEWGKVLRSPSWLVDGMPEEINHAIYLSYDDLDPHLKQCLLYCSLFPKYGKPNKHLIVEVWISEGFVN

FPrintScan: PR00364
IPR000767
198-213 DISEASERSIST
Disease resistance protein

VVAIVGVGGIGKTTLA

Gene3D: G3DSA:3.40.50.300
210-320 G3DSA:3.40.50.300

TTLAQNIFNHQDIKEKFDKIIWLSINQEFSDPELVRTAITGAGGEHSGHQELSLLQPILREAISGKKIFLVMDDMWSVHAWNNSLRIPLVNSAAQGSWVLITTRDERVARE

FPrintScan: PR00364
IPR000767
271-285 DISEASERSIST
Disease resistance protein

AISGKKIFLVMDDMW

FPrintScan: PR00364
IPR000767
370-384 DISEASERSIST
Disease resistance protein

CGGLPLAIKAIAGLL

Gene3D: G3DSA:3.80.10.10
488-710 G3DSA:3.80.10.10

DNNNWTMHDVVRSFCRHVAKDEALPFHMEHLRVTDLDSNRYRWLCIQNELDWSAWQEQNSVRTLFFYGSTHIKLKANDLCSKFSNLRVLSIVYAQLATFDSLCQLKNLRHLYFSRTDIRSLPDGIGKMKFLEYIGITCCEQIQQLPGSIIKLERLRSLNLMGTNIKSIPRGFGRLTSLRTLYSFPAQMGSSSSKDEWCSLEELGPLSQLRDLHIKGLENVSAS

superfamily: SSF52058
493-910 SSF52058,LRR

TMHDVVRSFCRHVAKDEALPFHMEHLRVTDLDSNRYRWLCIQNELDWSAWQEQNSVRTLFFYGSTHIKLKANDLCSKFSNLRVLSIVYAQLATFDSLCQLKNLRHLYFSRTDIRSLPDGIGKMKFLEYIGITCCEQIQQLPGSIIKLERLRSLNLMGTNIKSIPRGFGRLTSLRTLYSFPAQMGSSSSKDEWCSLEELGPLSQLRDLHIKGLENVSASSSAAKAMLGAKKHLAIWWLECTDRQRDDGFLKEEGIISIDEQRRIKEVFDELCPSYCLEQLYIRGYFGWQLPKWMTSKASVRLDRLTSLKLDGLPCCTKLPDGLCQLSCLKLLQIRRAPAIERIGHEFLQIQQHNGDCHPSRAAVAFPILETLEFTVVLELEEWVWEEHIQAMPLLHELTLDRCKLRQLPLGLAENMPGL

FPrintScan: PR00364
IPR000767
513-529 DISEASERSIST
Disease resistance protein

FHMEHLRVTDLDSNRYR

Gene3D: G3DSA:3.80.10.10
787-843 G3DSA:3.80.10.10

SKASVRLDRLTSLKLDGLPCCTKLPDGLCQLSCLKLLQIRRAPAIERIGHEFLQIQQ


List of References




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox