PRGDB00049870 (Os12g0131500)

From PRG Wiki
Jump to: navigation, search
Os12g0131500
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 115487177 (NM_001072608)
Gene Class CNL
Domain Type LRR, NBS, LRR, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa (japonica cultivar-group) Os12g0131500 (Os12g0131500) mRNA, complete cds.

DNA Sequence

ATGGTGAAGGCCATATCCGAGGCGGCAGACAGCCGGCTCATCACCAACACCAACCTTCTCCACTGGCTGATGCGCCTACATGCGGCGGCTCAGGAAGCCAAAGATGTCCTCGACGAATTCGAGGTCGACGGCTCAAACATCGCCCGCAAGCGCAAGGCCAGTGACCTCATACTGTCATCCCGATCTCTCAAGAATCTGGTCATTGCTGATGAAAGCCTGAAAAGGATAAAGATACCATCAATCATTTTCAAAATATCAAGAAATGGAAAGTTCTTCTCTAAATTATCTCTCAAGAATTTGGTCATTCCTGATGAAAGCCTGACAAGGTTGGAACATGTCGTCAAGACCCTTACACAGCTCTGCGCAACCTCAGCCACTTTCATTGAGCTCATCAAGATGGATGATTCCAAAACAAACCAGCTGCACAAGGCAGCAGAGGCCAGCTCTCATCTCCCGGTAGATGTCCCTGTGTTTGGCCGGGATGAGGTCAAGGAGTTCATCCTGAATCATGATCATCCAGAATCCAGCATTGGAACTGGTAAAGTAAGAGCAGCCAGGCACAACATTCTTGTTCTCCCAATAGTCGGTATGAGTGGCGTGGGGAAGACAACACTTGCCCAGGTCATCTACAATCATGCCAGAGTGAAGCAACACTTTGAGCATAGAGCTTGGGTCTATGTTTCTGAGGATTTCACCATCAAAAGAACTTTGCAAGAAATCCTGCATTCGTTCCAAGGACACGGTGGCGCTATTTTCAATGGCGATGAAAGCATGGAAGCTACCATCACCAAGCTCCGTATCAAGATCAGTGGAGGATGTAAATTCTTTTTGGTGCTAGACAACATGTGGGAAGAGATGTGCCAGGAATGGAGCGTGCTGCTCACAGCATTATCCGATGAGGCACCATTGCCGTGGGAGAGCTTCTGGCCTCTCTTTCAGTACCACACATTTGGTGGTGTGGAGGTTCCCCAACAAGATGACAACCGAAACATGCTATTGATCGCCCAAGGGATTGCAAAGAAGCTAGATGGATTACCATTAGCAGCAAAAGTAATAGGAAACCTGCTGAGATGTAGGTTCTCCTGGGATAATTGGAGAAGGGTTGCCGAGAGTGATTGGTGGAACTTGGAAGAAGCTCTCCAGGGTATTCTGCCATACCTCAGGGACAGGGTGGTCCAGATGTGGCTTGCGCACGATTTTATCCAGTGGAATGAGATTGCTGACGTTATGAGGCCAGATGATGTTGGGAGGCAGTTATTTGATGAGCTCGTGGAAAGGTCCTTCTTCCAACCCACATTTGTTAGTAACAACAATTCAGTTTCTCTACACCAGTGCTTCTTCCATGGTGAAAGATCAACAGGAGTATCGTCCTTAGCACCAGGAAATATTCGCCACCTGGCCCTGCAGGTTAATAGCCTGGAACAATGCCAGGAGCTGCACAAGTACAGAAATCTGCGTACTCTCCTAATATTTGGCCGTTGTGAGAGTGATGCATTTTTTAACCTTCTTGATGGGATGTTGGAGAAGTCACCAAGTATCCGTGTGCTAGACTTATTGATACGGGGAAAGCCCGACCTTCTCGACGTAGATCTGCATCACTTATCATACGTTAAAGCACCAGGGAAGGTATGGCCCAAAGATGCTAGGCCCCTGAGAAAACTGCGATTCCTTGATCTTTCATTTACAAAGATCACAAAGTTGAAGGATCTCCCCACCAACCTCCAAGTCCTGCATCTTCGTGGATATGATGCTGATCGTGTGCCACAAAGTATCACCAAGCTGACCAACCTACGGCATCTGTATGTAGATGGTTCAGCATTGTCCAAGATTCAAAGTATTGGACAGCAAACTGAACTTCAAGAGTTGGAGAGCTTCATTGCACGAAAGGGACAAGGATTCATGATAAGAGAGTTAAAGAACATGAGGGAGTTCACGGGGAGGCTGTGCATCCGTGGTATCGAGAATATCAGAAGTAAGGATGAAGCGATGGAAGCTAGATTGATGGACAAGAAACATGTGGGTGCCTTGGTGATCGAAGGGAAAAGAGTGCCCAAGTTTGCACTTGAAGGACTGCAACCACACACAAACATACAGGAACTCACCATCAAATTCTTCCAGGAACAAGATTTTCCTGATTGGGTGTGTCCAGATAACTTGGTTAATCTCTTACAGGTAAATCTTGAAAGCTACCACTTCTTGTCTACCATTCCACCATTGGGCCATCTGCCTTTGCTAAAGCTCCTCACCCTAAGAAAGCTTCCCTCAGTGAAGCATGCCAACGGCACATCATTCGGTGGTTTCCCATCTCTTGAGGAGTTCGAGCTTCATTCAATGGAGAAATGGGAGGAGTGGACAGAACCAGATGCAGCAGCTCATGCTTATGGGTTGTCGCTTTTCCTTGGACACCTCAGGAAGCTCCATCTTGCATACTGTCCATCACTGAGACGTTTCCCGCATCTTCCATGCTTTATCTGCATTGAAAGAGCTGAAGATCTCCAAGCCTGGAAGCTGGATCCTGGCATTACCAGCATGTTCTCAAGTCTTGTCATCCCTAATAACCTTGGCAGTCGAGTACTGCAACCACAACGTTGTAATGTCCGCGCAACAGTTCAAGTCCCTAGAAAATATTGA


Protein sequences

Name Description Sequence
hypothetical protein Os12g0131500 [Oryza sativa (japonica cultivar-group)].

MVKAISEAADSRLITNTNLLHWLMRLHAAAQEAKDVLDEFEVDGSNIARKRKASDLILSSRSLKNLVIADESLKRIKIPSIIFKISRNGKFFSKLSLKNLVIPDESLTRLEHVVKTLTQLCATSATFIELIKMDDSKTNQLHKAAEASSHLPVDVPVFGRDEVKEFILNHDHPESSIGTGKVRAARHNILVLPIVGMSGVGKTTLAQVIYNHARVKQHFEHRAWVYVSEDFTIKRTLQEILHSFQGHGGAIFNGDESMEATITKLRIKISGGCKFFLVLDNMWEEMCQEWSVLLTALSDEAPLPWESFWPLFQYHTFGGVEVPQQDDNRNMLLIAQGIAKKLDGLPLAAKVIGNLLRCRFSWDNWRRVAESDWWNLEEALQGILPYLRDRVVQMWLAHDFIQWNEIADVMRPDDVGRQLFDELVERSFFQPTFVSNNNSVSLHQCFFHGERSTGVSSLAPGNIRHLALQVNSLEQCQELHKYRNLRTLLIFGRCESDAFFNLLDGMLEKSPSIRVLDLLIRGKPDLLDVDLHHLSYVKAPGKVWPKDARPLRKLRFLDLSFTKITKLKDLPTNLQVLHLRGYDADRVPQSITKLTNLRHLYVDGSALSKIQSIGQQTELQELESFIARKGQGFMIRELKNMREFTGRLCIRGIENIRSKDEAMEARLMDKKHVGALVIEGKRVPKFALEGLQPHTNIQELTIKFFQEQDFPDWVCPDNLVNLLQVNLESYHFLSTIPPLGHLPLLKLLTLRKLPSVKHANGTSFGGFPSLEEFELHSMEKWEEWTEPDAAAHAYGLSLFLGHLRKLHLAYCPSLRRFPHLPCFICIERAEDLQAWKLDPGITSMFSSLVIPNNLGSRVLQPQRCNVRATVQVPRKY

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF121
1-869 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

MVKAISEAADSRLITNTNLLHWLMRLHAAAQEAKDVLDEFEVDGSNIARKRKASDLILSSRSLKNLVIADESLKRIKIPSIIFKISRNGKFFSKLSLKNLVIPDESLTRLEHVVKTLTQLCATSATFIELIKMDDSKTNQLHKAAEASSHLPVDVPVFGRDEVKEFILNHDHPESSIGTGKVRAARHNILVLPIVGMSGVGKTTLAQVIYNHARVKQHFEHRAWVYVSEDFTIKRTLQEILHSFQGHGGAIFNGDESMEATITKLRIKISGGCKFFLVLDNMWEEMCQEWSVLLTALSDEAPLPWESFWPLFQYHTFGGVEVPQQDDNRNMLLIAQGIAKKLDGLPLAAKVIGNLLRCRFSWDNWRRVAESDWWNLEEALQGILPYLRDRVVQMWLAHDFIQWNEIADVMRPDDVGRQLFDELVERSFFQPTFVSNNNSVSLHQCFFHGERSTGVSSLAPGNIRHLALQVNSLEQCQELHKYRNLRTLLIFGRCESDAFFNLLDGMLEKSPSIRVLDLLIRGKPDLLDVDLHHLSYVKAPGKVWPKDARPLRKLRFLDLSFTKITKLKDLPTNLQVLHLRGYDADRVPQSITKLTNLRHLYVDGSALSKIQSIGQQTELQELESFIARKGQGFMIRELKNMREFTGRLCIRGIENIRSKDEAMEARLMDKKHVGALVIEGKRVPKFALEGLQPHTNIQELTIKFFQEQDFPDWVCPDNLVNLLQVNLESYHFLSTIPPLGHLPLLKLLTLRKLPSVKHANGTSFGGFPSLEEFELHSMEKWEEWTEPDAAAHAYGLSLFLGHLRKLHLAYCPSLRRFPHLPCFICIERAEDLQAWKLDPGITSMFSSLVIPNNLGSRVLQPQRCNVRAT

HMMPanther: PTHR23155
1-869 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

MVKAISEAADSRLITNTNLLHWLMRLHAAAQEAKDVLDEFEVDGSNIARKRKASDLILSSRSLKNLVIADESLKRIKIPSIIFKISRNGKFFSKLSLKNLVIPDESLTRLEHVVKTLTQLCATSATFIELIKMDDSKTNQLHKAAEASSHLPVDVPVFGRDEVKEFILNHDHPESSIGTGKVRAARHNILVLPIVGMSGVGKTTLAQVIYNHARVKQHFEHRAWVYVSEDFTIKRTLQEILHSFQGHGGAIFNGDESMEATITKLRIKISGGCKFFLVLDNMWEEMCQEWSVLLTALSDEAPLPWESFWPLFQYHTFGGVEVPQQDDNRNMLLIAQGIAKKLDGLPLAAKVIGNLLRCRFSWDNWRRVAESDWWNLEEALQGILPYLRDRVVQMWLAHDFIQWNEIADVMRPDDVGRQLFDELVERSFFQPTFVSNNNSVSLHQCFFHGERSTGVSSLAPGNIRHLALQVNSLEQCQELHKYRNLRTLLIFGRCESDAFFNLLDGMLEKSPSIRVLDLLIRGKPDLLDVDLHHLSYVKAPGKVWPKDARPLRKLRFLDLSFTKITKLKDLPTNLQVLHLRGYDADRVPQSITKLTNLRHLYVDGSALSKIQSIGQQTELQELESFIARKGQGFMIRELKNMREFTGRLCIRGIENIRSKDEAMEARLMDKKHVGALVIEGKRVPKFALEGLQPHTNIQELTIKFFQEQDFPDWVCPDNLVNLLQVNLESYHFLSTIPPLGHLPLLKLLTLRKLPSVKHANGTSFGGFPSLEEFELHSMEKWEEWTEPDAAAHAYGLSLFLGHLRKLHLAYCPSLRRFPHLPCFICIERAEDLQAWKLDPGITSMFSSLVIPNNLGSRVLQPQRCNVRAT

Coil: coil
23-44 coiled-coil

LMRLHAAAQEAKDVLDEFEVDG

superfamily: SSF52540
140-380 P-loop containing nucleoside triphosphate hydrolases

QLHKAAEASSHLPVDVPVFGRDEVKEFILNHDHPESSIGTGKVRAARHNILVLPIVGMSGVGKTTLAQVIYNHARVKQHFEHRAWVYVSEDFTIKRTLQEILHSFQGHGGAIFNGDESMEATITKLRIKISGGCKFFLVLDNMWEEMCQEWSVLLTALSDEAPLPWESFWPLFQYHTFGGVEVPQQDDNRNMLLIAQGIAKKLDGLPLAAKVIGNLLRCRFSWDNWRRVAESDWWNLEEAL

HMMPfam: PF00931
IPR002182
186-299 NB-ARC,NBS
NB-ARC

RHNILVLPIVGMSGVGKTTLAQVIYNHARVKQHFEHRAWVYVSEDFTIKRTLQEILHSFQGHGGAIFNGDESMEATITKLRIKISGGCKFFLVLDNMWEEMCQEWSVLLTALSD

FPrintScan: PR00364
IPR000767
191-206 DISEASERSIST
Disease resistance protein

VLPIVGMSGVGKTTLA

FPrintScan: PR00364
IPR000767
269-283 DISEASERSIST
Disease resistance protein

ISGGCKFFLVLDNMW

HMMPfam: PF00931
IPR002182
306-382 NB-ARC,NBS
NB-ARC

ESFWPLFQYHTFGGVEVPQQDDNRNMLLIAQGIAKKLDGLPLAAKVIGNLLRCRFSWDNWRRVAESDWWNLEEALQG

FPrintScan: PR00364
IPR000767
342-356 DISEASERSIST
Disease resistance protein

LDGLPLAAKVIGNLL

ProfileScan: PS51450
IPR001611
462-483 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NIRHLALQVNSLEQCQELHKYR

superfamily: SSF52058
467-821 L domain-like,LRR

ALQVNSLEQCQELHKYRNLRTLLIFGRCESDAFFNLLDGMLEKSPSIRVLDLLIRGKPDLLDVDLHHLSYVKAPGKVWPKDARPLRKLRFLDLSFTKITKLKDLPTNLQVLHLRGYDADRVPQSITKLTNLRHLYVDGSALSKIQSIGQQTELQELESFIARKGQGFMIRELKNMREFTGRLCIRGIENIRSKDEAMEARLMDKKHVGALVIEGKRVPKFALEGLQPHTNIQELTIKFFQEQDFPDWVCPDNLVNLLQVNLESYHFLSTIPPLGHLPLLKLLTLRKLPSVKHANGTSFGGFPSLEEFELHSMEKWEEWTEPDAAAHAYGLSLFLGHLRKLHLAYCPSLRRFPHLP

FPrintScan: PR00364
IPR000767
549-565 DISEASERSIST
Disease resistance protein

RPLRKLRFLDLSFTKIT

ProfileScan: PS51450
IPR001611
553-574 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLRFLDLSFTKITKLKDLPTNL

ProfileScan: PS51450
IPR001611
596-617 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLRHLYVDGSALSKIQSIGQQT

Gene3D: G3DSA:3.80.10.10
686-811 no description

FALEGLQPHTNIQELTIKFFQEQDFPDWVCPDNLVNLLQVNLESYHFLSTIPPLGHLPLLKLLTLRKLPSVKHANGTSFGGFPSLEEFELHSMEKWEEWTEPDAAAHAYGLSLFLGHLRKLHLAYC

ProfileScan: PS51450
IPR001611
721-743 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLLQVNLESYHFLSTIPPLGHLP

Seg: seg
737-754 seg

PPLGHLPLLKLLTLRKLP


List of References




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox