PRGDB00049871 (Os12g0124100)

From PRG Wiki
Jump to: navigation, search
Os12g0124100
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 115487101 (NM_001072570)
Gene Class NL
Domain Type LRR, NBS, LRR, LRR, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa (japonica cultivar-group) Os12g0124100 (Os12g0124100) mRNA, partial cds.

DNA Sequence

GATGAGGAGAAGCACAAGATCATATGTAAGTTAATAGATGACCAACAGAAAATCTCAATAGTTTCAATTGTTGGACTTGGTGGAACCGGTAAAACTACTATGGCCACACACATCTGTCATGACAACAAAATAAAAGAGCATTTTGAAGGCTCAATATTTTGGGTTCACGTGTCACAAGAATTTGATAATAACAAACTCGTCGGCAAGCTGTATGAAGCCATTTTAAAGAAAACATCATATCTTCGTACCGACCAACAGATGGTTGAAGCAATTTCAAACGAGTTGAATGGGAATAAGTTTCTACTTGTCTTGGATGATGCTTGGCACAAGAATCAATATGACTGGGAACGATTCATGCTATATCTTAAGAGTGGATCACCTGGAAGCCGGATTTTGCTCACAACTCGTGATCAGGGAGTTGCGGAGGCAGTGGAATCTACATGTACATATAAGTTGGCTTTCTTGTCAGATGAGGACAGCTGGAATTTATTTCAACAAAGTTTAAGGTTAGCTGCAAAAGGTCTGCCCTCTGAATTTGTAGAAATTGGAAGAGAGATTATTAAAAAATGTGGTGGGGTGCCACTGGCAATTAAAATTCTTGCAGGTGTCCTCCGTAACAAGAAAACAGTAGATGCATGGTGTGCCTTACGTGATAGTAACATGTGGAATGTTGATGATATAGAAGATAGAGTGTTTGCGTCATTAAGGCTGAGCTATTTTCATCTGCCTGATCATCTGAAGCAATGTTTTGTATATTGCTCTATATTTCCTAAAGGCTACAAGATCTACAAACACCAGTTGATCGGAGAGTGGATAGCAAATGGCTTCATCAATCCAATGAATGAGATTGAACAAGTAGAGGATGTTGCAAATGACTGCTTTGATTCTCTTCTGAAAGTGCACTTTCTCCAAGATCTAGAGGTAGATGAGTATGATGAAATGGAAATATGCAAGATGCATGACCTGGTTCTTGACCTTACTCGGCAAATTTTACAGGGTGAAATGGTGTCTCATTCTCAGAATGCAACTATTGGTAATTCCCAAAAATGCAGATATTTATCTTTGGCTTCGTGCAATGAGAATATTGAAGTGAAGTTATTTAGCAAGGTCCATGCTATCTATATTTCTGGTGACAACTTCGCACTCAACAAGCCAATCAAGAAAAGGTGCCATGTTCGTTCTATTATTTTGGAGAGTATGGGCGCTACTAATTTGTTGCTTCCATTGATACCAAAGTTCGAATATCTTAGCTATTTTCGTATCTCACACGCTAGCTGTCGAGCCTTTCCAGAAGAAATCTCACATTGCTGGAACTTGCAGGCCCTTCATGTTACATATTGCAGGGCACTTACCACATTACCTGAGTCTATTGGTAAGCTTAAGAAGCTGAGAACCCTAGAGTTGTCATGTCTTTTGGATCTTGAAAGTTTGCCTCAGTCCATTGGTGACTGTCATAATCTTCAAAGCTTTCTCCTGCGTGGCAGTGGTATCAGGGAGATACCAAACTCCATATGTAAAATTAAAAAACTAAGAGTGCTTAACATTATGCATTGTCGCTCTTTGAGGCAACAATGGTCAGAATTCTTTGGGACGCTTTGCAACTTACAGTCCATCAACTTAGCACAGATTGAGGGTATCCACAACTTGTTCAGTTCATTTGCTTGTCATAAACTACGCACTTTGACACTTAGTGGAACCGAAATTACCAGACTACCGCAATGCCTCACATTGGTGAGCACCCTGGAATACATAGACCTTCAAAACTGCTGGGGGCTGCTAGAGTTATCGGAGGGCATAGGGAACCTAGAGAGGCTTGAAGTTTTGAACCTAAAAGGATGCTCGAATTTGGGTGGCCTGCCAGTAGGGATTGGACAGCTAACTCATCTTCAAAGGCTGCATTTGTTTGTTATAGGTGGCAGTAGCGAGCATGCAAGAATATCAGGGCTTCGAAACCTCAACTTGTTAACCGACAATGATCTGGAAATAAAAATTATTAAATATGTAGAGGATCCAGATGATGCAGAAAAGGCCTCCCTGAAGGAAAAGAGTGGTATACTCAATTTGACATTGGATTGGTCTTCAAATGGTGCAGAAGGGTGCTCGGATAGTCTGGAAGAAGAGCCATTATTAGATATGGAAAAGGAGCTGCGTGTGCTCAATGGTCTTGAACCACCATCACAAATTAAGAAGCTGAATATCTATAATTACAAAGGTAAGCATTTCTCACGTTGGATGATGAAGCAAAGAGAATCCTCTTGTTCAGATAGCTTGTTAGAGCAAATTGATCCACCTCATTTCACTCAACTGACTAAACTTGTATTGGAACAATTTCCAAACTTGGAGAATCTGCAAGGACTTGCACGGTTGCCTTCATTGAATACTTTTGTATTGAAAGGAATGCCTAATTTGGTGGAGTTGTGGACAAGCTCACCTGCATTAGTAAGTGGGGAGGAAGGAAAGCCCTGTTGTATTGATCACGAACAAGTTGAGCACTGCTTCCCTTTCCTATCCACTCTAGTCATGAGTGATTGTCCTAAGCTGAAGTAA


Protein sequences

Name Description Sequence
hypothetical protein Os12g0124100 [Oryza sativa (japonica cultivar-group)].

DEEKHKIICKLIDDQQKISIVSIVGLGGTGKTTMATHICHDNKIKEHFEGSIFWVHVSQEFDNNKLVGKLYEAILKKTSYLRTDQQMVEAISNELNGNKFLLVLDDAWHKNQYDWERFMLYLKSGSPGSRILLTTRDQGVAEAVESTCTYKLAFLSDEDSWNLFQQSLRLAAKGLPSEFVEIGREIIKKCGGVPLAIKILAGVLRNKKTVDAWCALRDSNMWNVDDIEDRVFASLRLSYFHLPDHLKQCFVYCSIFPKGYKIYKHQLIGEWIANGFINPMNEIEQVEDVANDCFDSLLKVHFLQDLEVDEYDEMEICKMHDLVLDLTRQILQGEMVSHSQNATIGNSQKCRYLSLASCNENIEVKLFSKVHAIYISGDNFALNKPIKKRCHVRSIILESMGATNLLLPLIPKFEYLSYFRISHASCRAFPEEISHCWNLQALHVTYCRALTTLPESIGKLKKLRTLELSCLLDLESLPQSIGDCHNLQSFLLRGSGIREIPNSICKIKKLRVLNIMHCRSLRQQWSEFFGTLCNLQSINLAQIEGIHNLFSSFACHKLRTLTLSGTEITRLPQCLTLVSTLEYIDLQNCWGLLELSEGIGNLERLEVLNLKGCSNLGGLPVGIGQLTHLQRLHLFVIGGSSEHARISGLRNLNLLTDNDLEIKIIKYVEDPDDAEKASLKEKSGILNLTLDWSSNGAEGCSDSLEEEPLLDMEKELRVLNGLEPPSQIKKLNIYNYKGKHFSRWMMKQRESSCSDSLLEQIDPPHFTQLTKLVLEQFPNLENLQGLARLPSLNTFVLKGMPNLVELWTSSPALVSGEEGKPCCIDHEQVEHCFPFLSTLVMSDCPKLK

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF221
1-848 PTHR23155:SF221,OS12G0124100 PROTEIN (FRAGMENT)

DEEKHKIICKLIDDQQKISIVSIVGLGGTGKTTMATHICHDNKIKEHFEGSIFWVHVSQEFDNNKLVGKLYEAILKKTSYLRTDQQMVEAISNELNGNKFLLVLDDAWHKNQYDWERFMLYLKSGSPGSRILLTTRDQGVAEAVESTCTYKLAFLSDEDSWNLFQQSLRLAAKGLPSEFVEIGREIIKKCGGVPLAIKILAGVLRNKKTVDAWCALRDSNMWNVDDIEDRVFASLRLSYFHLPDHLKQCFVYCSIFPKGYKIYKHQLIGEWIANGFINPMNEIEQVEDVANDCFDSLLKVHFLQDLEVDEYDEMEICKMHDLVLDLTRQILQGEMVSHSQNATIGNSQKCRYLSLASCNENIEVKLFSKVHAIYISGDNFALNKPIKKRCHVRSIILESMGATNLLLPLIPKFEYLSYFRISHASCRAFPEEISHCWNLQALHVTYCRALTTLPESIGKLKKLRTLELSCLLDLESLPQSIGDCHNLQSFLLRGSGIREIPNSICKIKKLRVLNIMHCRSLRQQWSEFFGTLCNLQSINLAQIEGIHNLFSSFACHKLRTLTLSGTEITRLPQCLTLVSTLEYIDLQNCWGLLELSEGIGNLERLEVLNLKGCSNLGGLPVGIGQLTHLQRLHLFVIGGSSEHARISGLRNLNLLTDNDLEIKIIKYVEDPDDAEKASLKEKSGILNLTLDWSSNGAEGCSDSLEEEPLLDMEKELRVLNGLEPPSQIKKLNIYNYKGKHFSRWMMKQRESSCSDSLLEQIDPPHFTQLTKLVLEQFPNLENLQGLARLPSLNTFVLKGMPNLVELWTSSPALVSGEEGKPCCIDHEQVEHCFPFLSTLVMSDCPKLK

HMMPanther: PTHR23155
1-848 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

DEEKHKIICKLIDDQQKISIVSIVGLGGTGKTTMATHICHDNKIKEHFEGSIFWVHVSQEFDNNKLVGKLYEAILKKTSYLRTDQQMVEAISNELNGNKFLLVLDDAWHKNQYDWERFMLYLKSGSPGSRILLTTRDQGVAEAVESTCTYKLAFLSDEDSWNLFQQSLRLAAKGLPSEFVEIGREIIKKCGGVPLAIKILAGVLRNKKTVDAWCALRDSNMWNVDDIEDRVFASLRLSYFHLPDHLKQCFVYCSIFPKGYKIYKHQLIGEWIANGFINPMNEIEQVEDVANDCFDSLLKVHFLQDLEVDEYDEMEICKMHDLVLDLTRQILQGEMVSHSQNATIGNSQKCRYLSLASCNENIEVKLFSKVHAIYISGDNFALNKPIKKRCHVRSIILESMGATNLLLPLIPKFEYLSYFRISHASCRAFPEEISHCWNLQALHVTYCRALTTLPESIGKLKKLRTLELSCLLDLESLPQSIGDCHNLQSFLLRGSGIREIPNSICKIKKLRVLNIMHCRSLRQQWSEFFGTLCNLQSINLAQIEGIHNLFSSFACHKLRTLTLSGTEITRLPQCLTLVSTLEYIDLQNCWGLLELSEGIGNLERLEVLNLKGCSNLGGLPVGIGQLTHLQRLHLFVIGGSSEHARISGLRNLNLLTDNDLEIKIIKYVEDPDDAEKASLKEKSGILNLTLDWSSNGAEGCSDSLEEEPLLDMEKELRVLNGLEPPSQIKKLNIYNYKGKHFSRWMMKQRESSCSDSLLEQIDPPHFTQLTKLVLEQFPNLENLQGLARLPSLNTFVLKGMPNLVELWTSSPALVSGEEGKPCCIDHEQVEHCFPFLSTLVMSDCPKLK

HMMPfam: PF00931
IPR002182
2-281 NB-ARC,NBS
NB-ARC

EEKHKIICKLIDDQQKISIVSIVGLGGTGKTTMATHICHDNKIKEHFEGSIFWVHVSQEFDNNKLVGKLYEAILKKTSYLRTDQQMVEAISNELNGNKFLLVLDDAWHKNQYDWERFMLYLKSGSPGSRILLTTRDQGVAEAVESTCTYKLAFLSDEDSWNLFQQSLRLAAKGLPSEFVEIGREIIKKCGGVPLAIKILAGVLRNKKTVDAWCALRDSNMWNVDDIEDRVFASLRLSYFHLPDHLKQCFVYCSIFPKGYKIYKHQLIGEWIANGFINPMN

Gene3D: G3DSA:3.40.50.300
14-110 G3DSA:3.40.50.300

DQQKISIVSIVGLGGTGKTTMATHICHDNKIKEHFEGSIFWVHVSQEFDNNKLVGKLYEAILKKTSYLRTDQQMVEAISNELNGNKFLLVLDDAWHK

superfamily: SSF52540
16-226 SSF52540

QKISIVSIVGLGGTGKTTMATHICHDNKIKEHFEGSIFWVHVSQEFDNNKLVGKLYEAILKKTSYLRTDQQMVEAISNELNGNKFLLVLDDAWHKNQYDWERFMLYLKSGSPGSRILLTTRDQGVAEAVESTCTYKLAFLSDEDSWNLFQQSLRLAAKGLPSEFVEIGREIIKKCGGVPLAIKILAGVLRNKKTVDAWCALRDSNMWNVDD

FPrintScan: PR00364
IPR000767
20-35 DISEASERSIST
Disease resistance protein

IVSIVGLGGTGKTTMA

FPrintScan: PR00364
IPR000767
94-108 DISEASERSIST
Disease resistance protein

ELNGNKFLLVLDDAW

FPrintScan: PR00364
IPR000767
190-204 DISEASERSIST
Disease resistance protein

CGGVPLAIKILAGVL

superfamily: SSF52058
318-845 SSF52058,LRR

KMHDLVLDLTRQILQGEMVSHSQNATIGNSQKCRYLSLASCNENIEVKLFSKVHAIYISGDNFALNKPIKKRCHVRSIILESMGATNLLLPLIPKFEYLSYFRISHASCRAFPEEISHCWNLQALHVTYCRALTTLPESIGKLKKLRTLELSCLLDLESLPQSIGDCHNLQSFLLRGSGIREIPNSICKIKKLRVLNIMHCRSLRQQWSEFFGTLCNLQSINLAQIEGIHNLFSSFACHKLRTLTLSGTEITRLPQCLTLVSTLEYIDLQNCWGLLELSEGIGNLERLEVLNLKGCSNLGGLPVGIGQLTHLQRLHLFVIGGSSEHARISGLRNLNLLTDNDLEIKIIKYVEDPDDAEKASLKEKSGILNLTLDWSSNGAEGCSDSLEEEPLLDMEKELRVLNGLEPPSQIKKLNIYNYKGKHFSRWMMKQRESSCSDSLLEQIDPPHFTQLTKLVLEQFPNLENLQGLARLPSLNTFVLKGMPNLVELWTSSPALVSGEEGKPCCIDHEQVEHCFPFLSTLVMSDCP

Gene3D: G3DSA:3.80.10.10
386-634 G3DSA:3.80.10.10

IKKRCHVRSIILESMGATNLLLPLIPKFEYLSYFRISHASCRAFPEEISHCWNLQALHVTYCRALTTLPESIGKLKKLRTLELSCLLDLESLPQSIGDCHNLQSFLLRGSGIREIPNSICKIKKLRVLNIMHCRSLRQQWSEFFGTLCNLQSINLAQIEGIHNLFSSFACHKLRTLTLSGTEITRLPQCLTLVSTLEYIDLQNCWGLLELSEGIGNLERLEVLNLKGCSNLGGLPVGIGQLTHLQRLHL

FPrintScan: PR00364
IPR000767
600-616 DISEASERSIST
Disease resistance protein

GNLERLEVLNLKGCSNL


List of References




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox