PRGDB00049872 (Os11g0704100)

From PRG Wiki
Jump to: navigation, search
Os11g0704100
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 115486796 (NM_001075074)
Gene Class CNL
Domain Type LRR, NBS, LRR, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa (japonica cultivar-group) Os11g0704100 (Os11g0704100) mRNA, complete cds.

DNA Sequence

ATGCATCGGCGTGGCGACCTGCACGCGCGGCGCGGCGGCGGTGTCGACCGATCGGCAACATCGTGCGGCGGAATTGCAGGTCATCGTCCTCGGCGCGACGGGACGGGACTAGTCGACGGCAGTCGCATGGTGCATATGCACACCTTGGAGAGGCTAGTGATGCTAGTCGTCGCTAGAGTCCGCATGTGTGTTAGTGTCGACCACTCACATATGGCCATTGTTCTGGATGCGTTCGCGTCATACGTCGGCGACCTGCTCAAGCAGGTGGCCAAGGACGAGGTCAACCTCCTCTTCGGCGTCTCCGGTGAGATCGCCACCCTCCACGACAAGCTGCGCATCCTCAAGGACTACCTCGCTGACGCCGATCGCCGACGTATCACCGACCAGAGTGTCCAAGGGTGGGTGACGAAGCTCAAGCACGCCATGTACGACGCCACCGACATCCTCGACCTCTGCCACCTCAAGGCCATGCAGCGCCAGCGCGGTGGTGGCAGCTCATCCTCCTCCAACCCTGTGGGCTGCCTGGACTCGCTGCTCTTCTGCCTCCGCAATCCACTCTTCGCCCACGACATTGGAAGCCGCATCAAGGCGCTCAACACCAGGCTCGACGCCATCTGCAAGAGCGCTGCCGCTTTCAGCTTCCTCAAGCTGGAGGCCTACGAGGACATGGCAGCGCCCCGACGGTCCAGCGCCACCGACCGCAGGACGGACCCGGTGCTGGGGAAGGAGAGATCGGGTGTTGTTGGGGAGAAAATCGAGGAGGACACCAGCGCGCTGGTGCAAAGGCTCACCAACGGCAACACGGCTATGACAACGATCATGGTGGTTGCCGTGGTGGGCACCGGCGGGATCGGCAAGACGACGCTGGCGAAGAAGGTGTTCAACGACGAGACCATCCAGAAAGCATTCCACAAGAAGATATGGCTGAGCGTGACGGAAGACGAGAACGAGGTGGAGCTCCTGAGGGAGGCCATCAAGTCCGCCGGCGGCGGCAGTGGCGCCGGCGATGCTCGAGACAGCAACAGCAAGTCCCTTCTTGTCGACGCCATCAGGAACAAGAGGTTCTTCCTTGTGCTAGACGACATGTGGAGTGACAGGGCATGGTGGAACCTGCTCAGGGAGCCCTTCAGCCATGGCGCCGTCGGCAGCCGTGTCCTCATAACCACTCGACATGACGACGTTGCCCGAGGGATGCAAGCCGTCCGCCCCTTCCACCACGTCCACAAACTGTATCCTCGAGATGCCTGGTCACTCCTCAAGAAACAGGTCCGTCGTGTTATTCTCCCATACAACAACGTACATGTAGCGTCAAGTGATATGGAGGAGCTTGAAATTGACGACATGCTCAAGGACATCGGAATGGAAATAATAGACAAATGTGACGGATTACCTCTTGCTGTAAAAGTAATGGGAGGACTGTTGCGCAGGAGGGAGAAACAGAGAGCCGATTGGGAACAAGTTCTGCAAGATTTTATATGGTCAGTACCTCCTGGTGAACTAAATGATGCGGTATACCTGAGCTATCAAGATTTGCCTTCTTGTTTGAAGCAGTGCTTTCTGCACTACTCCCTCCTCCCAAAAAATGTAGAATTCTACGATGTCACGGTCATTGGCATGTGGATAAGTGAAGGATTTCTTCACGGGGACACTGATGATTTAGAAAAATTAGGAGAAAGGTACTATCAAGAGTTAATTTACAGAAACCTAATAGAGCCAGATGTAGAATACGCTGATCAATGTGTTAGCACCATGCATGATGTCATTCGTTCATTTGCTCAAGATATCTCTAGAGATGAAGCACTTGTAGTTTCAACTTCAGATGAAAGAGGCAAAGGTGCACTTAGATCACAAAAGTTTCTTAGGCTGTCTGTAGAAACCAATGATTTTCAACCGAACGATGAACTTGAGTGGAAACTCATACAAGGCCAGGGATCACTTAGAACACTAATAGTGATTGGCGAGCTCAAGATTGACCATGGGGATTCGTTGATTAATTTTACAAGCCTAAGGACTCTGCACATAGAAGACACAAATTGTAGTGCATCCTTGGTTGAATCCTTGCACCAACTCAAGCACTTGAGGTATCTGTTCCTAGAATGCAGCGACATAGCTAGACTACTACAGAACATCAGCAAACTCAAATTATTGCAGTACCTTGAGATTATATCTGAAAATTTGGTCAGACTTCCTAACAGCATTGTAAAGCTAGGGCAGCTTAGGCATCTTGACCTTCTAGGCATAAGCATAAGTGGCATACCCCGACAGTTCTGTCGACTGACAAATTTGAGGTATTTGTATGGGTTTCCTGTACAAGCAGATGGTGACTGGTGTAGTTTACAAGAGCTGGGTCCTCTTGCTAAGCTACGGAGACTTGCACTAAGAAAGCTAGAGAATGTACCCGTTACCTCCTTGGCTAGAGAGGCTAGGCTTGGTGAGAAGTTGCATCTTCGCTACTTGAGATTAGAGTGTAGCAGTAGACTTGGTGAAGATGGGTTAGTAGAAGATGAGAAAGGTGTCTCTGAGGAAGAACAGCGGCGAATCGAGGAGGTGTTGGATGAGCTTACCCCACCCTTGTGCCTAGAAAATATTGATATCACAGGCTATTTTGGACAGCGGCTACCAAGGTGGATGATGTCAGGAGCAGCAGGTGCATATATGAGGTTGTTGATTGTGACGATGGATGACCTGGTCTGCTGCACCCAGCTCCCTGACGGCCTCTGCCAGCTCCCATGCCTCAACTTCTTTCAGGTCACCCGTGCCCCTGCAATCAAGCATGTTAGCCCTAAATTTGTTACTATGCAGCCATCATCGAGCCAATTCCGCCATGCCCATGCATTCCCAAAGTTGAAGGAGATGAGGCTGATCGACATGGTGGAGTTTGAGGAGTGGGAGTGGGATCATCAACTGAATAATGTCCCGGCCATGCCTGAATTGGAGGAGCTTATGCTCGAAAACTGCAAGCTGAGATGCCTTCCTCCTGGCCTTTCCTCACAAGCGACGGCTTTGACAAGCATGGGTCTATGTGACATCAAATATCTCAACTTTGTAGAGAGCTTTGCTTCTCTTGTCAAGCTTGAGCTGCAAGATAACCCTGACCTAGAGAGGGTCACTTCAATGCCTAGGTTGCAGAAGCTCATCATCATAGGCTGCCCGAAGATGAGGACATTGGAGGGTGTGCCTGAGCTACGGAAGCTAGCGCTGGAGGATTGCGACATGGAACAACTCCCGAGATACCTACAGCAAGGTGTGAGTCCTATGCATCTGGTGTTGGACTGCAGCTTAGAGCTGCTCACATCCATAGCCCTTGGAGAATCTGGTCCTGAGTGGGGCAAGTTGAGCCATGTCCAGCATGTCAAGGCCTATGCTGACCAAGGAGACGATAAAAGGAAGTGGCATGTGTTATACACAAGAGAACCCTACAGTTTCGAGACAAATATCGGTGACAGCCCTTCTTCCAATTCTGGAGCTTCAGAGGATGAGTAG


Protein sequences

Name Description Sequence
hypothetical protein Os11g0704100 [Oryza sativa (japonica cultivar-group)].

MHRRGDLHARRGGGVDRSATSCGGIAGHRPRRDGTGLVDGSRMVHMHTLERLVMLVVARVRMCVSVDHSHMAIVLDAFASYVGDLLKQVAKDEVNLLFGVSGEIATLHDKLRILKDYLADADRRRITDQSVQGWVTKLKHAMYDATDILDLCHLKAMQRQRGGGSSSSSNPVGCLDSLLFCLRNPLFAHDIGSRIKALNTRLDAICKSAAAFSFLKLEAYEDMAAPRRSSATDRRTDPVLGKERSGVVGEKIEEDTSALVQRLTNGNTAMTTIMVVAVVGTGGIGKTTLAKKVFNDETIQKAFHKKIWLSVTEDENEVELLREAIKSAGGGSGAGDARDSNSKSLLVDAIRNKRFFLVLDDMWSDRAWWNLLREPFSHGAVGSRVLITTRHDDVARGMQAVRPFHHVHKLYPRDAWSLLKKQVRRVILPYNNVHVASSDMEELEIDDMLKDIGMEIIDKCDGLPLAVKVMGGLLRRREKQRADWEQVLQDFIWSVPPGELNDAVYLSYQDLPSCLKQCFLHYSLLPKNVEFYDVTVIGMWISEGFLHGDTDDLEKLGERYYQELIYRNLIEPDVEYADQCVSTMHDVIRSFAQDISRDEALVVSTSDERGKGALRSQKFLRLSVETNDFQPNDELEWKLIQGQGSLRTLIVIGELKIDHGDSLINFTSLRTLHIEDTNCSASLVESLHQLKHLRYLFLECSDIARLLQNISKLKLLQYLEIISENLVRLPNSIVKLGQLRHLDLLGISISGIPRQFCRLTNLRYLYGFPVQADGDWCSLQELGPLAKLRRLALRKLENVPVTSLAREARLGEKLHLRYLRLECSSRLGEDGLVEDEKGVSEEEQRRIEEVLDELTPPLCLENIDITGYFGQRLPRWMMSGAAGAYMRLLIVTMDDLVCCTQLPDGLCQLPCLNFFQVTRAPAIKHVSPKFVTMQPSSSQFRHAHAFPKLKEMRLIDMVEFEEWEWDHQLNNVPAMPELEELMLENCKLRCLPPGLSSQATALTSMGLCDIKYLNFVESFASLVKLELQDNPDLERVTSMPRLQKLIIIGCPKMRTLEGVPELRKLALEDCDMEQLPRYLQQGVSPMHLVLDCSLELLTSIALGESGPEWGKLSHVQHVKAYADQGDDKRKWHVLYTREPYSFETNIGDSPSSNSGASEDE

Domains

Domain Start-End Description Sequence

Seg: seg
49-64 seg

LERLVMLVVARVRMCV

HMMPanther: PTHR23155
74-1067 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

VLDAFASYVGDLLKQVAKDEVNLLFGVSGEIATLHDKLRILKDYLADADRRRITDQSVQGWVTKLKHAMYDATDILDLCHLKAMQRQRGGGSSSSSNPVGCLDSLLFCLRNPLFAHDIGSRIKALNTRLDAICKSAAAFSFLKLEAYEDMAAPRRSSATDRRTDPVLGKERSGVVGEKIEEDTSALVQRLTNGNTAMTTIMVVAVVGTGGIGKTTLAKKVFNDETIQKAFHKKIWLSVTEDENEVELLREAIKSAGGGSGAGDARDSNSKSLLVDAIRNKRFFLVLDDMWSDRAWWNLLREPFSHGAVGSRVLITTRHDDVARGMQAVRPFHHVHKLYPRDAWSLLKKQVRRVILPYNNVHVASSDMEELEIDDMLKDIGMEIIDKCDGLPLAVKVMGGLLRRREKQRADWEQVLQDFIWSVPPGELNDAVYLSYQDLPSCLKQCFLHYSLLPKNVEFYDVTVIGMWISEGFLHGDTDDLEKLGERYYQELIYRNLIEPDVEYADQCVSTMHDVIRSFAQDISRDEALVVSTSDERGKGALRSQKFLRLSVETNDFQPNDELEWKLIQGQGSLRTLIVIGELKIDHGDSLINFTSLRTLHIEDTNCSASLVESLHQLKHLRYLFLECSDIARLLQNISKLKLLQYLEIISENLVRLPNSIVKLGQLRHLDLLGISISGIPRQFCRLTNLRYLYGFPVQADGDWCSLQELGPLAKLRRLALRKLENVPVTSLAREARLGEKLHLRYLRLECSSRLGEDGLVEDEKGVSEEEQRRIEEVLDELTPPLCLENIDITGYFGQRLPRWMMSGAAGAYMRLLIVTMDDLVCCTQLPDGLCQLPCLNFFQVTRAPAIKHVSPKFVTMQPSSSQFRHAHAFPKLKEMRLIDMVEFEEWEWDHQLNNVPAMPELEELMLENCKLRCLPPGLSSQATALTSMGLCDIKYLNFVESFASLVKLELQDNPDLERVTSMPRLQKLIIIGCPKMRTLEGVPELRKLAL

HMMPanther: PTHR23155:SF121
74-1067 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

VLDAFASYVGDLLKQVAKDEVNLLFGVSGEIATLHDKLRILKDYLADADRRRITDQSVQGWVTKLKHAMYDATDILDLCHLKAMQRQRGGGSSSSSNPVGCLDSLLFCLRNPLFAHDIGSRIKALNTRLDAICKSAAAFSFLKLEAYEDMAAPRRSSATDRRTDPVLGKERSGVVGEKIEEDTSALVQRLTNGNTAMTTIMVVAVVGTGGIGKTTLAKKVFNDETIQKAFHKKIWLSVTEDENEVELLREAIKSAGGGSGAGDARDSNSKSLLVDAIRNKRFFLVLDDMWSDRAWWNLLREPFSHGAVGSRVLITTRHDDVARGMQAVRPFHHVHKLYPRDAWSLLKKQVRRVILPYNNVHVASSDMEELEIDDMLKDIGMEIIDKCDGLPLAVKVMGGLLRRREKQRADWEQVLQDFIWSVPPGELNDAVYLSYQDLPSCLKQCFLHYSLLPKNVEFYDVTVIGMWISEGFLHGDTDDLEKLGERYYQELIYRNLIEPDVEYADQCVSTMHDVIRSFAQDISRDEALVVSTSDERGKGALRSQKFLRLSVETNDFQPNDELEWKLIQGQGSLRTLIVIGELKIDHGDSLINFTSLRTLHIEDTNCSASLVESLHQLKHLRYLFLECSDIARLLQNISKLKLLQYLEIISENLVRLPNSIVKLGQLRHLDLLGISISGIPRQFCRLTNLRYLYGFPVQADGDWCSLQELGPLAKLRRLALRKLENVPVTSLAREARLGEKLHLRYLRLECSSRLGEDGLVEDEKGVSEEEQRRIEEVLDELTPPLCLENIDITGYFGQRLPRWMMSGAAGAYMRLLIVTMDDLVCCTQLPDGLCQLPCLNFFQVTRAPAIKHVSPKFVTMQPSSSQFRHAHAFPKLKEMRLIDMVEFEEWEWDHQLNNVPAMPELEELMLENCKLRCLPPGLSSQATALTSMGLCDIKYLNFVESFASLVKLELQDNPDLERVTSMPRLQKLIIIGCPKMRTLEGVPELRKLAL

Seg: seg
162-169 seg

GGGSSSSS

superfamily: SSF52540
252-497 P-loop containing nucleoside triphosphate hydrolases

IEEDTSALVQRLTNGNTAMTTIMVVAVVGTGGIGKTTLAKKVFNDETIQKAFHKKIWLSVTEDENEVELLREAIKSAGGGSGAGDARDSNSKSLLVDAIRNKRFFLVLDDMWSDRAWWNLLREPFSHGAVGSRVLITTRHDDVARGMQAVRPFHHVHKLYPRDAWSLLKKQVRRVILPYNNVHVASSDMEELEIDDMLKDIGMEIIDKCDGLPLAVKVMGGLLRRREKQRADWEQVLQDFIWSVPP

HMMPfam: PF00931
IPR002182
253-547 NB-ARC,NBS
NB-ARC

EEDTSALVQRLTNGNTAMTTIMVVAVVGTGGIGKTTLAKKVFNDETIQKAFHKKIWLSVTEDENEVELLREAIKSAGGGSGAGDARDSNSKSLLVDAIRNKRFFLVLDDMWSDRAWWNLLREPFSHGAVGSRVLITTRHDDVARGMQAVRPFHHVHKLYPRDAWSLLKKQVRRVILPYNNVHVASSDMEELEIDDMLKDIGMEIIDKCDGLPLAVKVMGGLLRRREKQRADWEQVLQDFIWSVPPGELNDAVYLSYQDLPSCLKQCFLHYSLLPKNVEFYDVTVIGMWISEGFLH

Seg: seg
268-285 seg

TAMTTIMVVAVVGTGGIG

FPrintScan: PR00364
IPR000767
275-290 DISEASERSIST
Disease resistance protein

VVAVVGTGGIGKTTLA

Seg: seg
327-335 seg

SAGGGSGAG

FPrintScan: PR00364
IPR000767
349-363 DISEASERSIST
Disease resistance protein

AIRNKRFFLVLDDMW

FPrintScan: PR00364
IPR000767
460-474 DISEASERSIST
Disease resistance protein

CDGLPLAVKVMGGLL

superfamily: SSF52058
583-1076 L domain-like,LRR

TMHDVIRSFAQDISRDEALVVSTSDERGKGALRSQKFLRLSVETNDFQPNDELEWKLIQGQGSLRTLIVIGELKIDHGDSLINFTSLRTLHIEDTNCSASLVESLHQLKHLRYLFLECSDIARLLQNISKLKLLQYLEIISENLVRLPNSIVKLGQLRHLDLLGISISGIPRQFCRLTNLRYLYGFPVQADGDWCSLQELGPLAKLRRLALRKLENVPVTSLAREARLGEKLHLRYLRLECSSRLGEDGLVEDEKGVSEEEQRRIEEVLDELTPPLCLENIDITGYFGQRLPRWMMSGAAGAYMRLLIVTMDDLVCCTQLPDGLCQLPCLNFFQVTRAPAIKHVSPKFVTMQPSSSQFRHAHAFPKLKEMRLIDMVEFEEWEWDHQLNNVPAMPELEELMLENCKLRCLPPGLSSQATALTSMGLCDIKYLNFVESFASLVKLELQDNPDLERVTSMPRLQKLIIIGCPKMRTLEGVPELRKLALEDCDMEQLP

HMMSmart: SM00369
IPR003591
690-713 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LKHLRYLFLECSDIARLLQNISKL

HMMSmart: SM00369
IPR003591
736-759 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LGQLRHLDLLGISISGIPRQFCRL

Seg: seg
785-796 seg

LAKLRRLALRKL

Gene3D: G3DSA:3.40.50.300
810-811 no description

LG

Coil: coil
833-854 coiled-coil

VEDEKGVSEEEQRRIEEVLDEL

HMMSmart: SM00369
IPR003591
975-998 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

MPELEELMLENCKLRCLPPGLSSQ

Gene3D: G3DSA:3.80.10.10
977-1081 no description

ELEELMLENCKLRCLPPGLSSQATALTSMGLCDIKYLNFVESFASLVKLELQDNPDLERVTSMPRLQKLIIIGCPKMRTLEGVPELRKLALEDCDMEQLPRYLQQ

Seg: seg
977-984 seg

ELEELMLE

FPrintScan: PR00364
IPR000767
1017-1033 DISEASERSIST
Disease resistance protein

ESFASLVKLELQDNPDL

HMMSmart: SM00369
IPR003591
1059-1082 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

VPELRKLALEDCDMEQLPRYLQQG


List of References




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox