PRGDB00049874 (Os11g0689100)

From PRG Wiki
Jump to: navigation, search
Os11g0689100
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 115486686 (NM_001075019)
Gene Class NL
Domain Type NBS, LRR, LRR, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa (japonica cultivar-group) Os11g0689100 (Os11g0689100) mRNA, complete cds.

DNA Sequence

ATGGAGTTGGCGGTAGGTGCTTCGGAAGCCACCATGAGATCTCTCCTGGGCAAGCTGGGCAACCTTCTTGCCCAGGAGTATTCTCTGGTCAGCGGCGTCCGTGGTGACATCCAGTACATCAATGACGAGCTTGCCAGCATGCAGGCCTTCCTCCGTGACCTTAGCGTTGTGACGGAGGGTCACAACCATGACAACCGGAGGAAGGACTGGATGAAGCAGATCCGAGACGTCGCCTATGACGTTGAGGACTGCATCGATGACTTTGCGCACCGGCTCCCCCAGGATTCAATCAGCGATGCCAAATGCTCCTTCATACTCACAAAAATGTATGAACTCTTGACATGGTGGCCTCGTCGCGATATTGCTTCGAGAATTGCTGAACTCAAGGTACGGGCGCAACAGATCGCGGATCGGCGCAACAGATATGGAGTGAACAACCCAGAACACTGTGACAGCAGCAACAGTCCCAGACCCAGAGCCCATGCTGCGGCTCAAGACATTGCTGAGTATCAGGACACAAAACCTCAGATCGTCAGTATAAAGGAGCCTGTGGGGATGAAGACTGTCATGGAAAACCTTGAGAAGTGGCTAACCGAACCTCAACCTGATAAGGGGCGAGCTGTTCTGTCCATTGTCGGTTTCGGTGGTGTGGGGAAGACCACCATTGCCATGGCATTGTACAGAAAAGTCAGTGGTAAATTTGACTGCCAGGCGTCAGTCGCTGTGTCTCAGAACTATGATGAAGACGAAGTCCTCAGGAGTATTCTGAATCAAGTCAGCAAACAGGAGGAGGCCGGTGGCAGCACAGAAAGTAGTAGTAGAGATGAGAACACCAGGGAACCCCAGGGCAGCAGTAGCACATCAAGTAGAGAGGAGAACACTGCCGAGTCAGGCACTAAAAGGATGTTGAACAAGTTGAAGAAAGCCCTACCACTGTCACTACTCGGAGGGAATGATGATAAGACATCGGTCAGGCAGCAGGAAACAATGGGCTCTCTTCAGCTCCGCGAAGAACTGAAACGGCGCCTGGCCGAAAAGAGATATATCCTCTTGATTGATGATATTTGGTCTGCCAAGACATGGAACAGTATCATCATACCGTTTCTGCCTTCTGAAAATGATAAAGACAGCAGAATAATAGTGACTACAAGATTTCATGCTGTTGGTTCCACATGCTCCCCTAGACATAAAAATGATGAGGCCACATCCTCCCCTGGACATGGAAAGGATCTTTTGCATAAAGTTGATTTTCTCACAGGTGACAAGCCCCTAGATTTATTTAATGCAAGCATTCCTGACCCAATGAAAAGAACAGATAGAGACAAGAAGTTATCAAAGATATGTGGGGGATTGCCTTTGGCCATTGTCACCATGGCTGGTCTTGTAGCCTGCAACCCAAACAAAGCCAACTCCGATTGGAGTAAACTTTGCGAATCATTATTTCCATATCCAGTAACTACTCTTAACCTGGATGGGGTTACGAGGATACTGGATTGTTGTTACAATGATTTGCCTGCAGATCTCAAGACCTGCTTATTGTACTTGAGTATATTTCCAAAGGGTTGGAAAATTAGTAGGAAGCGGTTGGCCCGACGATGGATTGCTGAAGGTTTTGCTACTGAGAAGCAAGGGCTAACCGAAGAGGAAGTTGCAGAGGCATACTTTAATCAGCTCGCAAGAAGGAACTTAATACGCCCTGTGGAGCATGGCAGCAATGGGAAGGTAAAAGCCTTTCAAGTTCATGACATGGTTCTTGAATACATCATGTCGAAGTCAATCGAAGAGAATTTTATTACTGTGGTTGGTGGACACTGGCAGATGACTGCGCCAAGCAATAAAGTCCGTCGACTATCGTTGCAAAGCAGTGGATCCAAGCATGGAAATTCTACAAAAGGCCTGAACTTGGCTCAAGTGCGATCACTGACGGTGTTTGGGAACCTGAACCATGTTCCATTCCATTCATTCAACTATGGGATAATACAGGTGCTGGATCTTGAGGGTTGGAAGGGTTTGAAAGAGAGACATGTGACGGAGATATGTCAAATGCTTGTACTCAAGTATTTGAGCATCCGGCGGACAGAAATTGCCAAAATTCCCTCAAAGATTGAGAAACTTGAGTATTTGGAAACTCTTGACATAAGGGAGACATATGTCGAGGAGCTGCCTAAGTCTGTAGGCCAGCTAAAACGGATCAGTAGCATACTTGGGGGGAACAAAAATACACGGAAGGGGCTGAGGTTGCCTCAAGAAAAAAGAAATAAGGCAATGAAAAACCCGTCACCTCAAGGTAAAACAAAGGAGCCTGCAGAGAAAGGATTCTTGTCCCAAGAAAAAGCTAAAGGCACAATGAAGTCACTCCGTGTACTGTCAGGGATTGAGATCGTTGATGAATCAGCAGCAGTAGCTGCAAGCCTTCATCAGTTGACAGGACTAAGGAAGCTTGCCATATACAAGCTCAAAATAAGCGAGGAAAATGATACATTCAAAGAATTACTCTCCTCTATTGAGTACCTTGGCAGCTGCGGCCTGCAGACTCTGGCCATCAATGATGAGAATTCTAAATTTATCAACTCACTATACAACATGTCTGCACCTCCAAGATATCTAGTCTCCCTTGAGCTGTCCGGCAAGTTGAAATGGCTACCTGAGTGGATCACCAGCATTACTACTCTCAACAAGTTAACCATATCTATAACAGTTCTTACGACTGAAACTTTGGAGATCCTCCGCAATTTACCTTCATTGTTTTCCCTCACCTTTGCCTTTTCACTTAGTGCAGCGAAGCAAGATCAGGACACAGTAAAGGGCATCCTTGAGGACAATAAATTGGCCACTGACGGGGAAATCGTCATTCCAGCTAAAGAATTCAAGAGTCTTAAGCTGCTTCGCTTCTTTGCACCTTTCGTGCCAAAGCTCAGCTTTCCGGACAAGAGTGCAATGCCAGCACTCGAAATCATTGAAATGCGGTTTCAAGAATTTGAGGGTCTATTCGGCATCGAAATCCTTGAAAATCTCCGTGAGGTGCATCTCAAAGTTAGCGATGGGGCAGAAGCAATAACCAAGTTCCTAGTAAGTGATTTGAAGGATAATACTGAGAAACCAAAAGTATTTGTTGATGGCATCGTCACTGCATGA


Protein sequences

Name Description Sequence
hypothetical protein Os11g0689100 [Oryza sativa (japonica cultivar-group)].

MELAVGASEATMRSLLGKLGNLLAQEYSLVSGVRGDIQYINDELASMQAFLRDLSVVTEGHNHDNRRKDWMKQIRDVAYDVEDCIDDFAHRLPQDSISDAKCSFILTKMYELLTWWPRRDIASRIAELKVRAQQIADRRNRYGVNNPEHCDSSNSPRPRAHAAAQDIAEYQDTKPQIVSIKEPVGMKTVMENLEKWLTEPQPDKGRAVLSIVGFGGVGKTTIAMALYRKVSGKFDCQASVAVSQNYDEDEVLRSILNQVSKQEEAGGSTESSSRDENTREPQGSSSTSSREENTAESGTKRMLNKLKKALPLSLLGGNDDKTSVRQQETMGSLQLREELKRRLAEKRYILLIDDIWSAKTWNSIIIPFLPSENDKDSRIIVTTRFHAVGSTCSPRHKNDEATSSPGHGKDLLHKVDFLTGDKPLDLFNASIPDPMKRTDRDKKLSKICGGLPLAIVTMAGLVACNPNKANSDWSKLCESLFPYPVTTLNLDGVTRILDCCYNDLPADLKTCLLYLSIFPKGWKISRKRLARRWIAEGFATEKQGLTEEEVAEAYFNQLARRNLIRPVEHGSNGKVKAFQVHDMVLEYIMSKSIEENFITVVGGHWQMTAPSNKVRRLSLQSSGSKHGNSTKGLNLAQVRSLTVFGNLNHVPFHSFNYGIIQVLDLEGWKGLKERHVTEICQMLVLKYLSIRRTEIAKIPSKIEKLEYLETLDIRETYVEELPKSVGQLKRISSILGGNKNTRKGLRLPQEKRNKAMKNPSPQGKTKEPAEKGFLSQEKAKGTMKSLRVLSGIEIVDESAAVAASLHQLTGLRKLAIYKLKISEENDTFKELLSSIEYLGSCGLQTLAINDENSKFINSLYNMSAPPRYLVSLELSGKLKWLPEWITSITTLNKLTISITVLTTETLEILRNLPSLFSLTFAFSLSAAKQDQDTVKGILEDNKLATDGEIVIPAKEFKSLKLLRFFAPFVPKLSFPDKSAMPALEIIEMRFQEFEGLFGIEILENLREVHLKVSDGAEAITKFLVSDLKDNTEKPKVFVDGIVTA

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF220
8-1010 PTHR23155:SF220,OS11G0689100 PROTEIN

SEATMRSLLGKLGNLLAQEYSLVSGVRGDIQYINDELASMQAFLRDLSVVTEGHNHDNRRKDWMKQIRDVAYDVEDCIDDFAHRLPQDSISDAKCSFILTKMYELLTWWPRRDIASRIAELKVRAQQIADRRNRYGVNNPEHCDSSNSPRPRAHAAAQDIAEYQDTKPQIVSIKEPVGMKTVMENLEKWLTEPQPDKGRAVLSIVGFGGVGKTTIAMALYRKVSGKFDCQASVAVSQNYDEDEVLRSILNQVSKQEEAGGSTESSSRDENTREPQGSSSTSSREENTAESGTKRMLNKLKKALPLSLLGGNDDKTSVRQQETMGSLQLREELKRRLAEKRYILLIDDIWSAKTWNSIIIPFLPSENDKDSRIIVTTRFHAVGSTCSPRHKNDEATSSPGHGKDLLHKVDFLTGDKPLDLFNASIPDPMKRTDRDKKLSKICGGLPLAIVTMAGLVACNPNKANSDWSKLCESLFPYPVTTLNLDGVTRILDCCYNDLPADLKTCLLYLSIFPKGWKISRKRLARRWIAEGFATEKQGLTEEEVAEAYFNQLARRNLIRPVEHGSNGKVKAFQVHDMVLEYIMSKSIEENFITVVGGHWQMTAPSNKVRRLSLQSSGSKHGNSTKGLNLAQVRSLTVFGNLNHVPFHSFNYGIIQVLDLEGWKGLKERHVTEICQMLVLKYLSIRRTEIAKIPSKIEKLEYLETLDIRETYVEELPKSVGQLKRISSILGGNKNTRKGLRLPQEKRNKAMKNPSPQGKTKEPAEKGFLSQEKAKGTMKSLRVLSGIEIVDESAAVAASLHQLTGLRKLAIYKLKISEENDTFKELLSSIEYLGSCGLQTLAINDENSKFINSLYNMSAPPRYLVSLELSGKLKWLPEWITSITTLNKLTISITVLTTETLEILRNLPSLFSLTFAFSLSAAKQDQDTVKGILEDNKLATDGEIVIPAKEFKSLKLLRFFAPFVPKLSFPDKSAMPALEIIEMRFQEFEGLFGIEILENLREVHL

HMMPanther: PTHR23155
8-1010 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

SEATMRSLLGKLGNLLAQEYSLVSGVRGDIQYINDELASMQAFLRDLSVVTEGHNHDNRRKDWMKQIRDVAYDVEDCIDDFAHRLPQDSISDAKCSFILTKMYELLTWWPRRDIASRIAELKVRAQQIADRRNRYGVNNPEHCDSSNSPRPRAHAAAQDIAEYQDTKPQIVSIKEPVGMKTVMENLEKWLTEPQPDKGRAVLSIVGFGGVGKTTIAMALYRKVSGKFDCQASVAVSQNYDEDEVLRSILNQVSKQEEAGGSTESSSRDENTREPQGSSSTSSREENTAESGTKRMLNKLKKALPLSLLGGNDDKTSVRQQETMGSLQLREELKRRLAEKRYILLIDDIWSAKTWNSIIIPFLPSENDKDSRIIVTTRFHAVGSTCSPRHKNDEATSSPGHGKDLLHKVDFLTGDKPLDLFNASIPDPMKRTDRDKKLSKICGGLPLAIVTMAGLVACNPNKANSDWSKLCESLFPYPVTTLNLDGVTRILDCCYNDLPADLKTCLLYLSIFPKGWKISRKRLARRWIAEGFATEKQGLTEEEVAEAYFNQLARRNLIRPVEHGSNGKVKAFQVHDMVLEYIMSKSIEENFITVVGGHWQMTAPSNKVRRLSLQSSGSKHGNSTKGLNLAQVRSLTVFGNLNHVPFHSFNYGIIQVLDLEGWKGLKERHVTEICQMLVLKYLSIRRTEIAKIPSKIEKLEYLETLDIRETYVEELPKSVGQLKRISSILGGNKNTRKGLRLPQEKRNKAMKNPSPQGKTKEPAEKGFLSQEKAKGTMKSLRVLSGIEIVDESAAVAASLHQLTGLRKLAIYKLKISEENDTFKELLSSIEYLGSCGLQTLAINDENSKFINSLYNMSAPPRYLVSLELSGKLKWLPEWITSITTLNKLTISITVLTTETLEILRNLPSLFSLTFAFSLSAAKQDQDTVKGILEDNKLATDGEIVIPAKEFKSLKLLRFFAPFVPKLSFPDKSAMPALEIIEMRFQEFEGLFGIEILENLREVHL

superfamily: SSF52540
165-464 SSF52540

QDIAEYQDTKPQIVSIKEPVGMKTVMENLEKWLTEPQPDKGRAVLSIVGFGGVGKTTIAMALYRKVSGKFDCQASVAVSQNYDEDEVLRSILNQVSKQEEAGGSTESSSRDENTREPQGSSSTSSREENTAESGTKRMLNKLKKALPLSLLGGNDDKTSVRQQETMGSLQLREELKRRLAEKRYILLIDDIWSAKTWNSIIIPFLPSENDKDSRIIVTTRFHAVGSTCSPRHKNDEATSSPGHGKDLLHKVDFLTGDKPLDLFNASIPDPMKRTDRDKKLSKICGGLPLAIVTMAGLVAC

HMMPfam: PF00931
IPR002182
187-542 NB-ARC,NBS
NB-ARC

KTVMENLEKWLTEPQPDKGRAVLSIVGFGGVGKTTIAMALYRKVSGKFDCQASVAVSQNYDEDEVLRSILNQVSKQEEAGGSTESSSRDENTREPQGSSSTSSREENTAESGTKRMLNKLKKALPLSLLGGNDDKTSVRQQETMGSLQLREELKRRLAEKRYILLIDDIWSAKTWNSIIIPFLPSENDKDSRIIVTTRFHAVGSTCSPRHKNDEATSSPGHGKDLLHKVDFLTGDKPLDLFNASIPDPMKRTDRDKKLSKICGGLPLAIVTMAGLVACNPNKANSDWSKLCESLFPYPVTTLNLDGVTRILDCCYNDLPADLKTCLLYLSIFPKGWKISRKRLARRWIAEGFATEK

Gene3D: G3DSA:3.40.50.300
188-271 G3DSA:3.40.50.300

TVMENLEKWLTEPQPDKGRAVLSIVGFGGVGKTTIAMALYRKVSGKFDCQASVAVSQNYDEDEVLRSILNQVSKQEEAGGSTES

HMMSmart: SM00382
IPR003593
205-430 AAA,NBS
AAA+ ATPase domain

GRAVLSIVGFGGVGKTTIAMALYRKVSGKFDCQASVAVSQNYDEDEVLRSILNQVSKQEEAGGSTESSSRDENTREPQGSSSTSSREENTAESGTKRMLNKLKKALPLSLLGGNDDKTSVRQQETMGSLQLREELKRRLAEKRYILLIDDIWSAKTWNSIIIPFLPSENDKDSRIIVTTRFHAVGSTCSPRHKNDEATSSPGHGKDLLHKVDFLTGDKPLDLFNAS

FPrintScan: PR00364
IPR000767
208-223 DISEASERSIST
Disease resistance protein

VLSIVGFGGVGKTTIA

Gene3D: G3DSA:3.40.50.300
334-362 G3DSA:3.40.50.300

QLREELKRRLAEKRYILLIDDIWSAKTWN

FPrintScan: PR00364
IPR000767
448-462 DISEASERSIST
Disease resistance protein

CGGLPLAIVTMAGLV

superfamily: SSF52058
579-1010 SSF52058,LRR

QVHDMVLEYIMSKSIEENFITVVGGHWQMTAPSNKVRRLSLQSSGSKHGNSTKGLNLAQVRSLTVFGNLNHVPFHSFNYGIIQVLDLEGWKGLKERHVTEICQMLVLKYLSIRRTEIAKIPSKIEKLEYLETLDIRETYVEELPKSVGQLKRISSILGGNKNTRKGLRLPQEKRNKAMKNPSPQGKTKEPAEKGFLSQEKAKGTMKSLRVLSGIEIVDESAAVAASLHQLTGLRKLAIYKLKISEENDTFKELLSSIEYLGSCGLQTLAINDENSKFINSLYNMSAPPRYLVSLELSGKLKWLPEWITSITTLNKLTISITVLTTETLEILRNLPSLFSLTFAFSLSAAKQDQDTVKGILEDNKLATDGEIVIPAKEFKSLKLLRFFAPFVPKLSFPDKSAMPALEIIEMRFQEFEGLFGIEILENLREVHL

Gene3D: G3DSA:3.80.10.10
626-721 G3DSA:3.80.10.10

HGNSTKGLNLAQVRSLTVFGNLNHVPFHSFNYGIIQVLDLEGWKGLKERHVTEICQMLVLKYLSIRRTEIAKIPSKIEKLEYLETLDIRETYVEEL

FPrintScan: PR00364
IPR000767
703-719 DISEASERSIST
Disease resistance protein

EKLEYLETLDIRETYVE

Gene3D: G3DSA:3.80.10.10
802-920 G3DSA:3.80.10.10

AASLHQLTGLRKLAIYKLKISEENDTFKELLSSIEYLGSCGLQTLAINDENSKFINSLYNMSAPPRYLVSLELSGKLKWLPEWITSITTLNKLTISITVLTTETLEILRNLPSLFSLTF


List of References




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox