PRGDB00049876 (Os11g0687000)

From PRG Wiki
Jump to: navigation, search
Os11g0687000
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 115486672 (NM_001075012)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa (japonica cultivar-group) Os11g0687000 (Os11g0687000) mRNA, complete cds.

DNA Sequence

ATGGAGTCTGCCGTGGCGAGCGCATTGCTGAAGAGCGTCATGGGGAGGCTCTTCACGGTGCTAGAGAAGGAGTACAGCAAGCACAGGGAGCTGGCTCAAGAAACCAACTCCCTCCAGCAGGACCTCCGCATCGTTGCGGCGGCCATGGACGACCAGCTCCTTTCCATCAGGAGGAGCGACGCCCGCACGGCCGTCGCGCGGCTGCACAGCAAGGAGATGCTCGATCTTGCGCATGACATCGAGGACTACGTCGACCGCTTCATCCACCATCTCACTTGCAGGCAGCAGTGTGCTAGTGCCGGCCGGAACTCCCTTCTGGACCGGGTCGCCCACGAGCTCAAGAAGGTTCAGAGCCGCTCGAGCTTCGCCAACGAGATCCAGAAGCTCAAGAGGCCCCTCAGGCAAGTGCACCAGGATGTCATCAAGAACAATCCACTGGCTGGTGGTCAATCATCTTCCCCGTCTCCGCAAGATCGTCGCATCGCGGATAACCCGGTGGGCATAGAGGAGCCCGTGGAGGAGCTCCTCTCGCTGCTGGATGAGGTTGAGGGTGAGCCGGAGCGAATGAGGGTCATCTCCATCGTGGGATTCGGTGGATTGGGGAAGACAACCCTCGCCAAGGCGGTCTATGATAGCCCTCGCGTGAAGGAGAAATTCCACCTCCGTGCATGGGTTCCCGCCGGTGCCTCTCCGGAGACAAGCAGTGGGATGAGGGGGATCTTGCGTGCTGTGATACAGAAAATTCTTCCCAATGTTGCCATGGATGTTGACGGCCAACTTGAAACCTCGCTCAAAGAATACCTCAAGGACAAGAGAGGCTGGGTATTAATTGTGATCGATGACATCGGGATGGATCAATGGAGCATCATAAGTTCCACCTTTAAGGACAACGGTACAAGCAGCAGAATAATACTGACCACAACTATTCAATCAATAGCTAATAGCTGCAGCCATGGCAATGGTTATGTGCACCAAATGAACACGCTTGGTGAAGAGGACTGCAAGGAAATAGCCTTACCAACTGGGATAAGATCACCTGAGTTGGAGACTGGTTCAGTACCATTATTAGGCAAATGTGATGGCCTTCCTCTTGCTCTGGTCAGTGTATCTGATTATCTGAAGAGTTCGTGTGAGCCCACAGGAGAGCTGTGTGCAAACCTGTGCCGCAACCTCGGTGCTCATCTGAAAGAGCAGGATGGCCATCCCAGCTTTTCAGAACTCAGGAAGGTGCTTCTTGACAACTATGACAGTTTATCCGGCTATGCTCTCAGCTGCTTGCTGTATCTTGGTATATTCCCAAGCAATCGTCCTCTGAAAAAGAAAGTTGTAATCAGACGGTGGTTGGCTGAAGGATATGCAAGAAGTGATTCTCTTCGCAACGAAGAGGACATTGCAGTTGAGAATTTCAATAAGCTTATTGATCGGAATATCATTCTGCCTGTTGACACAAGAAACAATTCAGACGTGAAGACGTGCAAAACTCATGGAATTATGCATGAGTTTTTGCTGAACATGTCCTTGGCCCAGAGATTCATCATGACATTGTCTCGTGATCATCCAAGACTCATCTCCAATGCACGCCACCTTTCTGTCCATGATGGTGAACTGACAGGATACGTGACATCTGATGAAGAATTTTCTCGTGTCCGATCTCTAACTGTATTCGGGGATACAAGTGATACAGTCTCTTATGTTCGGAAGTGCAAGCTAATACGAGTATTGGATTTACAAGAATGTAATGATTTTGCTGACGATCATCTGAAACACATATGCAAATTATGGCATCTGAAATACCTGAGCTTTGGGTACAATATCAATGTGCTTCCAAGGAGCATTGAAGGACTGCATTGTTTGGAGACACTAGATTTAAGGAGAACCAAGATCAAGTTTTTGCCCATTGAAGCTGTCATGCTGCCCCACTTAGCTCACCTGTTTGGAAAGTTTATGCTGCATAAAGATGACCTGAAGAATGTCAACAAGATGAGTAAACTAAATCCTTGCAAGAAACAAAAAAAAGGGATGAATATACTACCAAAATTCTTCACATCAAAAAAGAGCAACTTGCAAACTCTAGCAGGTTTTATCACTGGTGAGAACGAAGGATTTCTGCAACTTATGGGTCATATGAAAAAACTGAGAAAGGTTAAGATATGGTGCAAGCATGTTGCAGGTAGCAGTAATTATATAGCTGATCTTTCACAGGCCATTCAGGAATTCACCAAGGTTCCTATTGACAGTGACAGTAACCGTTCTCTCTCACTTGATTCTGAAGAATGCTCTGAAAATTTCCTGAGCGCACTTCACTTGGAGCCATGCTCAGAAGATTTCAAATACCATCTAAGGTCACTAAAGCTGCAAGGCAGGTTCCTCCGATTGCCTCCATTTGTTACCTCGCTGTCAGGCCTCACGGAGCTTTTCATTTCATCAGCTACGCTGACACAAGATCATCTATCAGCACTGATCACTCTGAACAGACTTCTCTACCTCAAACTGATTTCAGACAAGCTTGAGAATTTTGAAATGAAACATGGGGCATTCCCGAGCCTGCGACGCCTGTGCTTTGTGGTTAAAAGTGTCACTTCAGATTTGCCAACAATCAAGCAAGGAGCTCTGCCAAACCTTGTCTCACTTCATCTGCTCTGTCGAGGTTTAGTCGGACTATCCGGCATCGAGATCAGACACCTGAAACATCTCAAGGAAGTCGTGATTGACTCTGACGTGACTCCACAAACAAAGCAAGACTGGGCACACGCAGCAAAAAACCACCCGAATAGACCTAAATTTTCATGGCCTCGAAAGGTTGATTTAGTGGAAAGCGAGGAACCGGCAAAACATCTTAAGACAGAGAAGAGGAAATATTGTTCAAATTATGAACTGGATTATAATCTTCAGGAGATGAGACTATCAGAGAGTAGAGACCATAAGAGGCAGAAAATTGGAGAAGGTGATACTAGCAAAAGTTCTGTGGGTCTTGTATATCCTATGTATGGAGATGTTGAAACTGATAGAACACAAGTTCACTTATTTAACCAAGAGACAAGAAGGTACGATCGGACTGAAGTTGATCAGAAGTGTCCTGAAATGTTGCAGGAATACAAAGATAAACACTCCATGGTGGTGGATGTTGATTTGAGATCAGATGAACAAGTCAATCCTCCCCATCCCAAGTTGAAGAATCTGATGCCTGGGAAGGAATATGATCGACAGGAGCTGATACCAACAGAGGGAGCAAAAGTGGGCCAATGCCAATCAGGTGGTGATGAAGATCAAATTGTTCATAACACTAATGGCAAGAAGGTTGTTGTGCAAGCCAATCATTTCTTTGAACAAGAGGACCAGGGCTCTCAAGTAACAATGTCATATGAATCAAGTTCTCTCTTGTCACACATGGATACTAAATCGTTGTGA


Protein sequences

Name Description Sequence
hypothetical protein Os11g0687000 [Oryza sativa (japonica cultivar-group)].

MESAVASALLKSVMGRLFTVLEKEYSKHRELAQETNSLQQDLRIVAAAMDDQLLSIRRSDARTAVARLHSKEMLDLAHDIEDYVDRFIHHLTCRQQCASAGRNSLLDRVAHELKKVQSRSSFANEIQKLKRPLRQVHQDVIKNNPLAGGQSSSPSPQDRRIADNPVGIEEPVEELLSLLDEVEGEPERMRVISIVGFGGLGKTTLAKAVYDSPRVKEKFHLRAWVPAGASPETSSGMRGILRAVIQKILPNVAMDVDGQLETSLKEYLKDKRGWVLIVIDDIGMDQWSIISSTFKDNGTSSRIILTTTIQSIANSCSHGNGYVHQMNTLGEEDCKEIALPTGIRSPELETGSVPLLGKCDGLPLALVSVSDYLKSSCEPTGELCANLCRNLGAHLKEQDGHPSFSELRKVLLDNYDSLSGYALSCLLYLGIFPSNRPLKKKVVIRRWLAEGYARSDSLRNEEDIAVENFNKLIDRNIILPVDTRNNSDVKTCKTHGIMHEFLLNMSLAQRFIMTLSRDHPRLISNARHLSVHDGELTGYVTSDEEFSRVRSLTVFGDTSDTVSYVRKCKLIRVLDLQECNDFADDHLKHICKLWHLKYLSFGYNINVLPRSIEGLHCLETLDLRRTKIKFLPIEAVMLPHLAHLFGKFMLHKDDLKNVNKMSKLNPCKKQKKGMNILPKFFTSKKSNLQTLAGFITGENEGFLQLMGHMKKLRKVKIWCKHVAGSSNYIADLSQAIQEFTKVPIDSDSNRSLSLDSEECSENFLSALHLEPCSEDFKYHLRSLKLQGRFLRLPPFVTSLSGLTELFISSATLTQDHLSALITLNRLLYLKLISDKLENFEMKHGAFPSLRRLCFVVKSVTSDLPTIKQGALPNLVSLHLLCRGLVGLSGIEIRHLKHLKEVVIDSDVTPQTKQDWAHAAKNHPNRPKFSWPRKVDLVESEEPAKHLKTEKRKYCSNYELDYNLQEMRLSESRDHKRQKIGEGDTSKSSVGLVYPMYGDVETDRTQVHLFNQETRRYDRTEVDQKCPEMLQEYKDKHSMVVDVDLRSDEQVNPPHPKLKNLMPGKEYDRQELIPTEGAKVGQCQSGGDEDQIVHNTNGKKVVVQANHFFEQEDQGSQVTMSYESSSLLSHMDTKSL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF268
6-952 PTHR23155:SF268,SUBFAMILY NOT NAMED

ASALLKSVMGRLFTVLEKEYSKHRELAQETNSLQQDLRIVAAAMDDQLLSIRRSDARTAVARLHSKEMLDLAHDIEDYVDRFIHHLTCRQQCASAGRNSLLDRVAHELKKVQSRSSFANEIQKLKRPLRQVHQDVIKNNPLAGGQSSSPSPQDRRIADNPVGIEEPVEELLSLLDEVEGEPERMRVISIVGFGGLGKTTLAKAVYDSPRVKEKFHLRAWVPAGASPETSSGMRGILRAVIQKILPNVAMDVDGQLETSLKEYLKDKRGWVLIVIDDIGMDQWSIISSTFKDNGTSSRIILTTTIQSIANSCSHGNGYVHQMNTLGEEDCKEIALPTGIRSPELETGSVPLLGKCDGLPLALVSVSDYLKSSCEPTGELCANLCRNLGAHLKEQDGHPSFSELRKVLLDNYDSLSGYALSCLLYLGIFPSNRPLKKKVVIRRWLAEGYARSDSLRNEEDIAVENFNKLIDRNIILPVDTRNNSDVKTCKTHGIMHEFLLNMSLAQRFIMTLSRDHPRLISNARHLSVHDGELTGYVTSDEEFSRVRSLTVFGDTSDTVSYVRKCKLIRVLDLQECNDFADDHLKHICKLWHLKYLSFGYNINVLPRSIEGLHCLETLDLRRTKIKFLPIEAVMLPHLAHLFGKFMLHKDDLKNVNKMSKLNPCKKQKKGMNILPKFFTSKKSNLQTLAGFITGENEGFLQLMGHMKKLRKVKIWCKHVAGSSNYIADLSQAIQEFTKVPIDSDSNRSLSLDSEECSENFLSALHLEPCSEDFKYHLRSLKLQGRFLRLPPFVTSLSGLTELFISSATLTQDHLSALITLNRLLYLKLISDKLENFEMKHGAFPSLRRLCFVVKSVTSDLPTIKQGALPNLVSLHLLCRGLVGLSGIEIRHLKHLKEVVIDSDVTPQTKQDWAHAAKNHPNRPKFSWPRKVDLVESEEPAKHLKTEKRK

HMMPanther: PTHR23155
6-952 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

ASALLKSVMGRLFTVLEKEYSKHRELAQETNSLQQDLRIVAAAMDDQLLSIRRSDARTAVARLHSKEMLDLAHDIEDYVDRFIHHLTCRQQCASAGRNSLLDRVAHELKKVQSRSSFANEIQKLKRPLRQVHQDVIKNNPLAGGQSSSPSPQDRRIADNPVGIEEPVEELLSLLDEVEGEPERMRVISIVGFGGLGKTTLAKAVYDSPRVKEKFHLRAWVPAGASPETSSGMRGILRAVIQKILPNVAMDVDGQLETSLKEYLKDKRGWVLIVIDDIGMDQWSIISSTFKDNGTSSRIILTTTIQSIANSCSHGNGYVHQMNTLGEEDCKEIALPTGIRSPELETGSVPLLGKCDGLPLALVSVSDYLKSSCEPTGELCANLCRNLGAHLKEQDGHPSFSELRKVLLDNYDSLSGYALSCLLYLGIFPSNRPLKKKVVIRRWLAEGYARSDSLRNEEDIAVENFNKLIDRNIILPVDTRNNSDVKTCKTHGIMHEFLLNMSLAQRFIMTLSRDHPRLISNARHLSVHDGELTGYVTSDEEFSRVRSLTVFGDTSDTVSYVRKCKLIRVLDLQECNDFADDHLKHICKLWHLKYLSFGYNINVLPRSIEGLHCLETLDLRRTKIKFLPIEAVMLPHLAHLFGKFMLHKDDLKNVNKMSKLNPCKKQKKGMNILPKFFTSKKSNLQTLAGFITGENEGFLQLMGHMKKLRKVKIWCKHVAGSSNYIADLSQAIQEFTKVPIDSDSNRSLSLDSEECSENFLSALHLEPCSEDFKYHLRSLKLQGRFLRLPPFVTSLSGLTELFISSATLTQDHLSALITLNRLLYLKLISDKLENFEMKHGAFPSLRRLCFVVKSVTSDLPTIKQGALPNLVSLHLLCRGLVGLSGIEIRHLKHLKEVVIDSDVTPQTKQDWAHAAKNHPNRPKFSWPRKVDLVESEEPAKHLKTEKRK

superfamily: SSF52540
147-375 SSF52540

AGGQSSSPSPQDRRIADNPVGIEEPVEELLSLLDEVEGEPERMRVISIVGFGGLGKTTLAKAVYDSPRVKEKFHLRAWVPAGASPETSSGMRGILRAVIQKILPNVAMDVDGQLETSLKEYLKDKRGWVLIVIDDIGMDQWSIISSTFKDNGTSSRIILTTTIQSIANSCSHGNGYVHQMNTLGEEDCKEIALPTGIRSPELETGSVPLLGKCDGLPLALVSVSDYLKS

Gene3D: G3DSA:3.40.50.300
168-308 G3DSA:3.40.50.300

IEEPVEELLSLLDEVEGEPERMRVISIVGFGGLGKTTLAKAVYDSPRVKEKFHLRAWVPAGASPETSSGMRGILRAVIQKILPNVAMDVDGQLETSLKEYLKDKRGWVLIVIDDIGMDQWSIISSTFKDNGTSSRIILTTT

HMMPfam: PF00931
IPR002182
169-453 NB-ARC,NBS
NB-ARC

EEPVEELLSLLDEVEGEPERMRVISIVGFGGLGKTTLAKAVYDSPRVKEKFHLRAWVPAGASPETSSGMRGILRAVIQKILPNVAMDVDGQLETSLKEYLKDKRGWVLIVIDDIGMDQWSIISSTFKDNGTSSRIILTTTIQSIANSCSHGNGYVHQMNTLGEEDCKEIALPTGIRSPELETGSVPLLGKCDGLPLALVSVSDYLKSSCEPTGELCANLCRNLGAHLKEQDGHPSFSELRKVLLDNYDSLSGYALSCLLYLGIFPSNRPLKKKVVIRRWLAEGYA

FPrintScan: PR00364
IPR000767
191-206 DISEASERSIST
Disease resistance protein

VISIVGFGGLGKTTLA

FPrintScan: PR00364
IPR000767
269-283 DISEASERSIST
Disease resistance protein

KDKRGWVLIVIDDIG

FPrintScan: PR00364
IPR000767
359-373 DISEASERSIST
Disease resistance protein

CDGLPLALVSVSDYL

Gene3D: G3DSA:3.80.10.10
452-464 G3DSA:3.80.10.10

YARSDSLRNEEDI

superfamily: SSF52058
503-905 SSF52058,LRR

LNMSLAQRFIMTLSRDHPRLISNARHLSVHDGELTGYVTSDEEFSRVRSLTVFGDTSDTVSYVRKCKLIRVLDLQECNDFADDHLKHICKLWHLKYLSFGYNINVLPRSIEGLHCLETLDLRRTKIKFLPIEAVMLPHLAHLFGKFMLHKDDLKNVNKMSKLNPCKKQKKGMNILPKFFTSKKSNLQTLAGFITGENEGFLQLMGHMKKLRKVKIWCKHVAGSSNYIADLSQAIQEFTKVPIDSDSNRSLSLDSEECSENFLSALHLEPCSEDFKYHLRSLKLQGRFLRLPPFVTSLSGLTELFISSATLTQDHLSALITLNRLLYLKLISDKLENFEMKHGAFPSLRRLCFVVKSVTSDLPTIKQGALPNLVSLHLLCRGLVGLSGIEIRHLKHLKEVVIDS

Gene3D: G3DSA:3.80.10.10
547-716 G3DSA:3.80.10.10

SRVRSLTVFGDTSDTVSYVRKCKLIRVLDLQECNDFADDHLKHICKLWHLKYLSFGYNINVLPRSIEGLHCLETLDLRRTKIKFLPIEAVMLPHLAHLFGKFMLHKDDLKNVNKMSKLNPCKKQKKGMNILPKFFTSKKSNLQTLAGFITGENEGFLQLMGHMKKLRKVK

FPrintScan: PR00364
IPR000767
566-582 DISEASERSIST
Disease resistance protein

RKCKLIRVLDLQECNDF

Gene3D: G3DSA:3.80.10.10
758-901 G3DSA:3.80.10.10

ECSENFLSALHLEPCSEDFKYHLRSLKLQGRFLRLPPFVTSLSGLTELFISSATLTQDHLSALITLNRLLYLKLISDKLENFEMKHGAFPSLRRLCFVVKSVTSDLPTIKQGALPNLVSLHLLCRGLVGLSGIEIRHLKHLKEV


List of References




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox