PRGDB00049877 (Os11g0686900)

From PRG Wiki
Jump to: navigation, search
Os11g0686900
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 115486670 (NM_001075011)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa (japonica cultivar-group) Os11g0686900 (Os11g0686900) mRNA, complete cds.

DNA Sequence

ATGGAGGCTCCGACCTGTGGTTTGTGGGGCGCCGTGTTGAACCTCCCCGGGAGGCTCGACGGGGTCCTCCTTCGCCATGGCAGCATTCTTCCCAAGGGTGCCGAGGAGGAGATACCGCTCATCAAGCGAGATCTCCATCTTATGATCTCCATACTCAATGGCTATTACAGCGAGTCGCCGGAGCTGGAGGATGCCACGGCGACGACGGTGGCGAGGAGGAGGTGCTGGACGAAGGAGGTGCGCGAGCTGTCCTACGACATCGAGGACTGCATCGACCACTACGAGCACGCTGCCACCGCCGGTTCAGCGGGCGGTCGAACCGCCAGCGGCGGGATTCCTCCTCGCCGTAAGATCACCAGGCGGCGGTGGCAGCGTACGACTCCTCTCTGGATTCCAGAGAGGCTGAAGCAGCGGTTATGGATGGCTAACAAGATCAGAGAATTCAGCCTACGTGCCCAGGACGCGCTCAAACGCCATGCCATGTTCTGCAGCAGCGTCGGTGGCAATGGCATAGCCACCAGTACTGCTTCTTCCTCTACTGCCGCTACAGGTGACGCATCGTCTTCTTCTTCTACCATATGTTGGCACACCACGCGGTTCAGGGAACGCGACTTCTGCGTCCCTCATGTCGGTATCAACGTCGCCATGAACAAGCTCGAAGACTGGCTCACTGCGTGTGATGATGAAGATCAGAAGAGGCTGAGGGTGGTGTCCATTGTAGGAGTCGGAGGAATAGGCAAGACCACGCTCGCCAACGAGCTGTACCGCAAGCTTCGGCGGCAGTTCGAATGCTGGGCATTTGTGCGTTCCTCCCAGAAGCCTGATGTAAGGAGGATTCTCATCAGCATCCTCTCACAGCTGCGCTTGCAGCAGCCACCTGAAAGTTGGAAGGTTCATAGCCTAATTTCCAGTATTAGGGCGCATCTGCAGGATAAGAGGTACTTGATCATAGTTGATGATATATGTTTTATATCAACATGGGATATTATTAAGTGTGCTTTACCAGATGGTACAAGTAGCAGCAGAGTACTAACAACGACACAATATGATGATCTAGCAGTCCAATCATGTGGTTATGACACCAAGTATGTTTTCAAGATGAAATCTCTTTCTCAACACGACTCAAGATATTTATTTTTCAATACAGTTTCTGGCAGTCGCTTTATTTATTCTCCAGGATCCACTGAAGTTTCAGATGATATTATAAGGAAATGTGGTAGTTTGCCACTAGCTATTGTATCTATTACCAGTATTCTAGAGAAGTCGAGGAAAATGGAGCAATGGGGTTATGTAAACAAATCCTTAGGCTACAATTTGATGAAAAACCCTACCTTGGAGGGGATAAAACAAGTGTTGGACCTTAGTTACAATAATCTTTCTGAGCATTTGAAGCCATGTGTGCTGTATCTTAGTATATATCAAGAGGACTACTTAATTTGTAAGGATGATTTGGTGAATCAATGGTTGGCTGAAGGGCTTATCTGTGCAACAAAAGATCACACTAAGGAAGAAATTTCAGAGGCCTGTTTTGGTGAGCTTGTCAGTAGTAAAATGATCCAACCAGTACATATTGATGGCAATGGTGACGTTATGTCCTTCGTTATTCAACATATGGTACTCAATTTTATTAGTTACAAGTCTATAGAAGAGAACTTCGTCACTGTAATACATCATTCTCAGACAGCTACCAAACTTTCTGACAAGGTTCGTCGATTGTCTCTTCACTTTGGTAATGTTAAAGATGCAAAGTTACCAATAAATATGAGACTTTCACAAGTTCGAACACTTGCCTTCTTTGGGGCCTACAAGTATTGGTGGCGTTCAATCAAAGATCAATTCCCACTTCTCCAAGTTCTTATCCTTCATTTTTGGCATGATGAGGATATTATCAGTTTTGACCTCACTATAATTTCACAGCTTTTTCGACTGAAATATTTAAAGATCACATCTGATGTTACTTTAGAACTGCAAACCAAGACAAGAGGCCTGCAATGTTTGGAAACACTTAAGATAGATGCAAGAATAAGTACAGCTCCATTAGACACAACTCATTTGTCGGGTTTACTCCATCTGAGTCTTCCTGCTGATACAAACTTGGCCAATGGAATTGGCCACATGACATCGCTTCACACATTTGGGTATTTTGATCTCAGCTATAACTCTGTAGAGAACGTGCTTAGCCTTGGCAAGCTGACCAATCTCCGAAATCTTCAGCTCACTTGTTCCACCATACGACCTAACAGTCTGGAGATTAAATTGCAGTGCCTGGGTTTCATTCTTCAAAAACTCAGCAACCTCAAGTCTGTAACTATGTCAACTGCAGGCTCCTCTTGTGTAAATTCTACTGATGCGAGTTCTGCAAACGTTAGCGTTAGAATTTCTGGTGATGGCTTGAGCAGCATGTCCTCTCCCCCGGCACTTGTTGAGAGGCTTGAGTTGTTGCCACGAATTTGCATATTCTCCTACCTCCCGAAGTGGATCAGTCTACTCAGCAAGCTCCGTATTTTGAAGATTGGGGTAAGGGAACTAGTGAGAAATGATATTGATGTTCTCATGGGATTGCGTGCTCTCACTGATCTCTCGCTACATGTCCACACCAAGCCTACAGAAATTATTTTCTTTGGCGGTATAGGATTCAAGGCTCTCAAGTACTTAAAGATCAATTGCTGTGTAGCTTGGTTGAAATTTGATATGGGTGCAATGCATAGTCTCTATAAGCTCAAGCTTGGTTATAATGTCGATGGAGTTGATCAAGAAAGTACGATACCAGTTGGCATTCAGTACTTATATGGCCTCAAAGAGATCTCCGTAAAAATTGGTGGTGCTGATCCTGAGAAATACGACAGAAGGGCTGAAGAGTTGGCGTTCATGATCGACTCAGGTCTGCATGACAGATGCATGAGCATCACTTTACAATGCGTGAGGCAGATGTTTGATTTCAACGAAGATAAGAGTAGCCTGACACATGAAGAACAAAGGAAATTGAAACAACAGGAGATCCTGGAGGATGACTCTGACGAAGAATATGACGAAATTATTCAGGACTCTGGGGAGCAAGAAGTGAAACAGTAA


Protein sequences

Name Description Sequence
hypothetical protein Os11g0686900 [Oryza sativa (japonica cultivar-group)].

MEAPTCGLWGAVLNLPGRLDGVLLRHGSILPKGAEEEIPLIKRDLHLMISILNGYYSESPELEDATATTVARRRCWTKEVRELSYDIEDCIDHYEHAATAGSAGGRTASGGIPPRRKITRRRWQRTTPLWIPERLKQRLWMANKIREFSLRAQDALKRHAMFCSSVGGNGIATSTASSSTAATGDASSSSSTICWHTTRFRERDFCVPHVGINVAMNKLEDWLTACDDEDQKRLRVVSIVGVGGIGKTTLANELYRKLRRQFECWAFVRSSQKPDVRRILISILSQLRLQQPPESWKVHSLISSIRAHLQDKRYLIIVDDICFISTWDIIKCALPDGTSSSRVLTTTQYDDLAVQSCGYDTKYVFKMKSLSQHDSRYLFFNTVSGSRFIYSPGSTEVSDDIIRKCGSLPLAIVSITSILEKSRKMEQWGYVNKSLGYNLMKNPTLEGIKQVLDLSYNNLSEHLKPCVLYLSIYQEDYLICKDDLVNQWLAEGLICATKDHTKEEISEACFGELVSSKMIQPVHIDGNGDVMSFVIQHMVLNFISYKSIEENFVTVIHHSQTATKLSDKVRRLSLHFGNVKDAKLPINMRLSQVRTLAFFGAYKYWWRSIKDQFPLLQVLILHFWHDEDIISFDLTIISQLFRLKYLKITSDVTLELQTKTRGLQCLETLKIDARISTAPLDTTHLSGLLHLSLPADTNLANGIGHMTSLHTFGYFDLSYNSVENVLSLGKLTNLRNLQLTCSTIRPNSLEIKLQCLGFILQKLSNLKSVTMSTAGSSCVNSTDASSANVSVRISGDGLSSMSSPPALVERLELLPRICIFSYLPKWISLLSKLRILKIGVRELVRNDIDVLMGLRALTDLSLHVHTKPTEIIFFGGIGFKALKYLKINCCVAWLKFDMGAMHSLYKLKLGYNVDGVDQESTIPVGIQYLYGLKEISVKIGGADPEKYDRRAEELAFMIDSGLHDRCMSITLQCVRQMFDFNEDKSSLTHEEQRKLKQQEILEDDSDEEYDEIIQDSGEQEVKQ

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF196
9-889 PTHR23155:SF196,OS11G0225300 PROTEIN

WGAVLNLPGRLDGVLLRHGSILPKGAEEEIPLIKRDLHLMISILNGYYSESPELEDATATTVARRRCWTKEVRELSYDIEDCIDHYEHAATAGSAGGRTASGGIPPRRKITRRRWQRTTPLWIPERLKQRLWMANKIREFSLRAQDALKRHAMFCSSVGGNGIATSTASSSTAATGDASSSSSTICWHTTRFRERDFCVPHVGINVAMNKLEDWLTACDDEDQKRLRVVSIVGVGGIGKTTLANELYRKLRRQFECWAFVRSSQKPDVRRILISILSQLRLQQPPESWKVHSLISSIRAHLQDKRYLIIVDDICFISTWDIIKCALPDGTSSSRVLTTTQYDDLAVQSCGYDTKYVFKMKSLSQHDSRYLFFNTVSGSRFIYSPGSTEVSDDIIRKCGSLPLAIVSITSILEKSRKMEQWGYVNKSLGYNLMKNPTLEGIKQVLDLSYNNLSEHLKPCVLYLSIYQEDYLICKDDLVNQWLAEGLICATKDHTKEEISEACFGELVSSKMIQPVHIDGNGDVMSFVIQHMVLNFISYKSIEENFVTVIHHSQTATKLSDKVRRLSLHFGNVKDAKLPINMRLSQVRTLAFFGAYKYWWRSIKDQFPLLQVLILHFWHDEDIISFDLTIISQLFRLKYLKITSDVTLELQTKTRGLQCLETLKIDARISTAPLDTTHLSGLLHLSLPADTNLANGIGHMTSLHTFGYFDLSYNSVENVLSLGKLTNLRNLQLTCSTIRPNSLEIKLQCLGFILQKLSNLKSVTMSTAGSSCVNSTDASSANVSVRISGDGLSSMSSPPALVERLELLPRICIFSYLPKWISLLSKLRILKIGVRELVRNDIDVLMGLRALTDLSLHVHTKPTEIIFFGGIGFKALKYLKINC

HMMPanther: PTHR23155
9-889 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

WGAVLNLPGRLDGVLLRHGSILPKGAEEEIPLIKRDLHLMISILNGYYSESPELEDATATTVARRRCWTKEVRELSYDIEDCIDHYEHAATAGSAGGRTASGGIPPRRKITRRRWQRTTPLWIPERLKQRLWMANKIREFSLRAQDALKRHAMFCSSVGGNGIATSTASSSTAATGDASSSSSTICWHTTRFRERDFCVPHVGINVAMNKLEDWLTACDDEDQKRLRVVSIVGVGGIGKTTLANELYRKLRRQFECWAFVRSSQKPDVRRILISILSQLRLQQPPESWKVHSLISSIRAHLQDKRYLIIVDDICFISTWDIIKCALPDGTSSSRVLTTTQYDDLAVQSCGYDTKYVFKMKSLSQHDSRYLFFNTVSGSRFIYSPGSTEVSDDIIRKCGSLPLAIVSITSILEKSRKMEQWGYVNKSLGYNLMKNPTLEGIKQVLDLSYNNLSEHLKPCVLYLSIYQEDYLICKDDLVNQWLAEGLICATKDHTKEEISEACFGELVSSKMIQPVHIDGNGDVMSFVIQHMVLNFISYKSIEENFVTVIHHSQTATKLSDKVRRLSLHFGNVKDAKLPINMRLSQVRTLAFFGAYKYWWRSIKDQFPLLQVLILHFWHDEDIISFDLTIISQLFRLKYLKITSDVTLELQTKTRGLQCLETLKIDARISTAPLDTTHLSGLLHLSLPADTNLANGIGHMTSLHTFGYFDLSYNSVENVLSLGKLTNLRNLQLTCSTIRPNSLEIKLQCLGFILQKLSNLKSVTMSTAGSSCVNSTDASSANVSVRISGDGLSSMSSPPALVERLELLPRICIFSYLPKWISLLSKLRILKIGVRELVRNDIDVLMGLRALTDLSLHVHTKPTEIIFFGGIGFKALKYLKINC

superfamily: SSF52540
192-442 SSF52540

TICWHTTRFRERDFCVPHVGINVAMNKLEDWLTACDDEDQKRLRVVSIVGVGGIGKTTLANELYRKLRRQFECWAFVRSSQKPDVRRILISILSQLRLQQPPESWKVHSLISSIRAHLQDKRYLIIVDDICFISTWDIIKCALPDGTSSSRVLTTTQYDDLAVQSCGYDTKYVFKMKSLSQHDSRYLFFNTVSGSRFIYSPGSTEVSDDIIRKCGSLPLAIVSITSILEKSRKMEQWGYVNKSLGYNLMKN

Gene3D: G3DSA:3.40.50.300
214-351 G3DSA:3.40.50.300

VAMNKLEDWLTACDDEDQKRLRVVSIVGVGGIGKTTLANELYRKLRRQFECWAFVRSSQKPDVRRILISILSQLRLQQPPESWKVHSLISSIRAHLQDKRYLIIVDDICFISTWDIIKCALPDGTSSSRVLTTTQYDD

HMMPfam: PF00931
IPR002182
229-496 NB-ARC,NBS
NB-ARC

EDQKRLRVVSIVGVGGIGKTTLANELYRKLRRQFECWAFVRSSQKPDVRRILISILSQLRLQQPPESWKVHSLISSIRAHLQDKRYLIIVDDICFISTWDIIKCALPDGTSSSRVLTTTQYDDLAVQSCGYDTKYVFKMKSLSQHDSRYLFFNTVSGSRFIYSPGSTEVSDDIIRKCGSLPLAIVSITSILEKSRKMEQWGYVNKSLGYNLMKNPTLEGIKQVLDLSYNNLSEHLKPCVLYLSIYQEDYLICKDDLVNQWLAEGLICA

FPrintScan: PR00364
IPR000767
236-251 DISEASERSIST
Disease resistance protein

VVSIVGVGGIGKTTLA

FPrintScan: PR00364
IPR000767
308-322 DISEASERSIST
Disease resistance protein

HLQDKRYLIIVDDIC

FPrintScan: PR00364
IPR000767
405-419 DISEASERSIST
Disease resistance protein

CGSLPLAIVSITSIL

superfamily: SSF52058
518-912 SSF52058,LRR

MIQPVHIDGNGDVMSFVIQHMVLNFISYKSIEENFVTVIHHSQTATKLSDKVRRLSLHFGNVKDAKLPINMRLSQVRTLAFFGAYKYWWRSIKDQFPLLQVLILHFWHDEDIISFDLTIISQLFRLKYLKITSDVTLELQTKTRGLQCLETLKIDARISTAPLDTTHLSGLLHLSLPADTNLANGIGHMTSLHTFGYFDLSYNSVENVLSLGKLTNLRNLQLTCSTIRPNSLEIKLQCLGFILQKLSNLKSVTMSTAGSSCVNSTDASSANVSVRISGDGLSSMSSPPALVERLELLPRICIFSYLPKWISLLSKLRILKIGVRELVRNDIDVLMGLRALTDLSLHVHTKPTEIIFFGGIGFKALKYLKINCCVAWLKFDMGAMHSLYKLKLGYN

Gene3D: G3DSA:3.80.10.10
563-727 G3DSA:3.80.10.10

TKLSDKVRRLSLHFGNVKDAKLPINMRLSQVRTLAFFGAYKYWWRSIKDQFPLLQVLILHFWHDEDIISFDLTIISQLFRLKYLKITSDVTLELQTKTRGLQCLETLKIDARISTAPLDTTHLSGLLHLSLPADTNLANGIGHMTSLHTFGYFDLSYNSVENVLS

Gene3D: G3DSA:3.80.10.10
728-911 G3DSA:3.80.10.10

LGKLTNLRNLQLTCSTIRPNSLEIKLQCLGFILQKLSNLKSVTMSTAGSSCVNSTDASSANVSVRISGDGLSSMSSPPALVERLELLPRICIFSYLPKWISLLSKLRILKIGVRELVRNDIDVLMGLRALTDLSLHVHTKPTEIIFFGGIGFKALKYLKINCCVAWLKFDMGAMHSLYKLKLGY

FPrintScan: PR00364
IPR000767
761-777 DISEASERSIST
Disease resistance protein

QKLSNLKSVTMSTAGSS


List of References




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox