PRGDB00049879 (Os11g0686400)

From PRG Wiki
Jump to: navigation, search
Os11g0686400
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 115486666 (NM_001075009)
Gene Class CNL
Domain Type NBS, LRR, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa (japonica cultivar-group) Os11g0686400 (Os11g0686400) mRNA, complete cds.

DNA Sequence

ATGTTCAACCTCCCCAGGAGGCTGGAGGAGCTGCTGTGTCATCACGGTAGCATGCTGCCCAAGGGCGCAGACGAGGAGATACCACTCATCAAGCAAGATCTTGAGGAAATAATCTCAATCCTCCATGGTCACAGTGAGCCAAAACTGGAGGACCATAGCATGGTGGTCAGGTGCTGGATGAAGGAGGTGCGTGAGCTCTCTTACGACATCGAGGACAGTATTGACCAGTACGAGCATGCCGCCAGGTCTCAGAATAGACCTAATATTCACCACCGTAAGTTCAATCGGTGGCGTGGAAACAAGATCCCATGTATTCCCCAGAAACTGAAACAACGGTTGTGGATGGCCAACAAGATCAGAGAATTCAGCCTGCGCATCCAGGATGCGCTTCAACGCCATGCCATGTACAACAACCTCGGTGGTGTCGCTGGTACTGCTTCTACTACTAGAGGAGATGTATGCTCTGCCACACCTTGGCATCCCACAAAGACGCAGTTCAGAGAGCATGTCGACAACGTCCGTTCTGTCAGTATAGATGTCGATGGTATGGAAGCTGCCCTGAATGACTTGAACAAGCTCAAAAACTTGCTTGCTGGCATCCCGACTGCTTCTCTCGTGCAGTTCAGGGAGCATGCCGACAAAGTCCGTGGTATCCACACCGATATAGAAGCCATCCTGAACAAGCTCGAAAACATACCCCCTGGCATCACCACCACTACTACTACTACTACTAGAGGTGATGCATTCATGGAGTCCACCTGTCATGTTGGCATTGGCGCCGCCATGAACAAGCTTGAAAACTTGCTCGATTTGTGTGGAGAGGAGAAGCTCAAGGTGGTGTCCATCGTGGGAGTTGGAGGAGTTGGCAAGACTACGCTTGCCAACAAGCTGTACCGCAAGCTTCGGTGGCAGTTCGAGTGCCGGGCATTTGTGCGGACATCCCAGAAGACTGATATGAGGAGGCTTCTCATCAATATCCTCTTACAGATTCGGTCGCACCAATCACCTGACAATTGGAAGGTGCATAGCCTGATTTCCAGTATCAGGACATATCTGCAAGATAAGAGGGGGTGTGTCTGTTGCTTGCTATCCCTGATATCAGCCTTAGCCACAATTAGGCCTCATTTGGCAAAAGATATCCCACCCATCAAAGGGTTCTTGATCGTAATTGATGATCTATGGGCTACATCCACATGGGATATTATTAAGTGCGCTTTGCCGGAGGGTAACAAGTCTAGCAGAATACTGACCACAACAGAAATTGAAGATCTAGCTTTGCAATCTTGTAGTTATGACTTGAAATTTATTTTCAAGATGATACCTTTTGGTGAGGATGACTCAAGAAAACTATTATTCAGTATAGTCTTTGGCTCTCATTCTAAGTGTCCTCCAGAAGTCAGTGAAACATTATATGATATTGTAAGGAAATGTGGTGGCTTGCCGCTAGCTATTGTCACTGTTGCAAGTCTTTTAGCAAGCCAGCTTGATAAACTGGAACAATGGGATTATATAAACAAATCCTTAGGTTACAGTTTGATGGCAAATCCTACTTTGGAAGGGATGAAACAACTACTGAACCTTTGTTACAACAATCTTCCTCAGCATTTGAAGGCATGCATGTTGTATCTTAGTATGTATCAAGGAGATCACATAATTTGGAAGGATGATTTAGTGAATCAATGGATAGCTGAAGGTTTTATCTGTGCAACTGAAGAGCATGACAAGGAAGAAATTTCAAGGGGCTATTTTGATGAGCTTGTTGGTAGAAAAATCATCCAGCCTGTCCATATCGATGACAGCGGTGAGGTTTTGTCCTGTGTAGTTCACCATATTGTACTCAATTTTGTTACATACAAGTCAATAGAAGAGAATTTTATTATTGCAATAGACCATTCACAGGCAACTATAAGATTTGCTGACAAGGTTCGACGATTATCTATTCACTTCAATAATGTAGAAGATGCACCTCCACCTACTAATATGAGATTGTTCCAAGTTCGGACAATTGCCTTCTTTGGGGTCTTGAAGTATATGCCTTTCATTATGGAGTTTCGACTTATTAAAGTTTTATTTCTACATTTTTTGGGTGATGAGGATAGCACCGGCATTGTTGATCTCACTAAAATTTCAGAACTTGTCCGACTGAGATATTTGAAGGTCACCTCTAATGCCACCGTAAAACTGCCAACCCGGTTGCAAGGTCTACCATATTTGGAGACACTGAAAATAGATGGAAAAATAAGTGAAGTTCCAACAGACATTTATTTGCCAGGTTTGCTGCATCTTACTCTTCCTGCTAAGACAAACCTGCCCAGTGGAATTGTCCACATGACATCGCTTCGTACAATTGAATATTTTGATCTCAGCTGTAACTCAGCGGAGAATCTATGGAGCCTTGGTGAGCTGAGCAATCTCCGGGATTTGCAGCTCACCTATTCTGAAATACATTCTGACAATCTGAAGGATAATATGAAATATCTTGGATCCATTCTGGGGAAACTCCGTAATCTCACATCTATAACTTTATCGCCTCCTGGCTCTTCCTGTCCAGATACTCTACATATTGACAGGGATACAAAGACGAGGATCAATGTTGATGGCTGGAGCAGTGTGTCCTCTCCACCAGCCCTTCTTCAGAGGTTTGAGTTGTTACCATGTGTTTGCATCTTTTCTAACCTCCCAAATTGGATTGGGCAGCTTGGAAACCTCTGCATTTTGAAGATTGGGATAAGGGAAGTAACAAGTAATAATATTGATGTTCTCGGAGTATTACCAGAGCTCACTGTTTTGTCACTTTATGTCCACACAAAGCCTGCAGAAAGGATTGTCTTTGACAATGCAGGGTTCTCAATCCTCAGATACTTCAAGTTTATATGCAGTGTAGCATGGATGAAATTTGAGGTTGGTGCAATGCCTAGTCTAAGGAAGCTCAAGTTAGGTTTTGATGTCCATAGAGCAGATCAGCATGATATTATTCCTGTTGGCATCGAACATCTGTCTGGACTTGAAGAGATCTCTGCCAAAATTAGGGTCGCTTCTACTGCTCATGATCATTGTAGAAGATTTGCAGAGTCAGCTTTGACTAACGCTATTAGGATGCATCCAGGACGTCCTAGCGTCAACATCCGATGTGTAGATTGGACCTTTGATGGTATGGATGTTAGCAATGCCGGGACACGGGAGGGAGAATGCAGGATTCTGAAAAAACAACAAAATATCGTGAAAGAAAGCTCTACTGAGAAGTCTGCAGTTCTAGAAAAGGATCGTGGGGATGGAGCAAATAAATCTGATGAAAGCAGGTGGCCTTCGTCAGTTGATCCAAGGACAGTGACAGCCAAATCCGACACTTTTTTGGTCGCCTGCGTTCCCTTGGCTGGTTTTGAGTGTGGCGCATGCAATGAAGCAGGTTGCAAGGGGATGAGATTGGCGGGACGACAAGCTGCATTTATGGTGGCATGTGGGCATGATAGTGGGCAAGGCCTGCTAGATCTAGCCTTTCCTTGCTCAGACTCACTGGTGGCGGATGGCTACAGCTACGCGAATTGCTACGTTGTTAGGGACTGTTTGGTGGAGCTTTTAGCAACTGGAGATTCTAGGGAGAAGCTACCTATGGAAATGTGGCATGTGAGGAGTAATACGGAGGATGACGGCCTCAGCTGGAGTAAGTACGAGCAGAAGGAGATCCTCGGCGCCAAGTTCCCAAGAGCTTATTTCCGGTGCACACACTGGAACACGAAGAAGGGATGCATGGCGACCAAGGAGGTGCAGCGCGACGACGGTGACCCCCTCATGTTCGACATCGTATACCACGGTGAGCACACTTGCACTCAGACCGCGGAGTCCAATGTCGACGAACAGATCAGATTAACGCGAACGCGAGACAAGAAGGTAAAGAGAACGAAGAGGAAAAGGCAAGTGAGGGTGACCTCCGTGCCGGCGGATGACGGCTACAGCTGGAGGAAGTACGGGCAGAAGAACGTCCTCGGCTTCAGTTACCTAAGGGGTTACTACAGGTGTGCCACCAAGGGCTGCCAGGCGTCCAAGCAAGTGCAGCGCCACGACGACGGCTTGCTCTTCGACGTCACATACTTTGGTGAGCACACCTGCGCTGATCAGCCTCAGGCAGCGCACTCCAGCGACCAAGTACAGGTCACATTATGGCCGCCTGCCAGCACGATCCTGGAGCGGCCGACATTCAAGACGCGTTTGCAAGGTCAAGTGGACGCCATGGAGAAGCAGCACGAAGGCTTCAGGAAGATGCTGTCCAGTATTCAGGAGGCGATCGGCGCCATGTCGGTGAAGCAAGGCGAGGTGCAGGAGACGATGAACAAAATGGAGAAATCCATTTCAAGTTGGCGACCTCAGGTTGATGCTGCGGTGCAGAGCTTGCAGCGCGACATGGAGTTGCAGAGAAATCAAGTCGGTGCGGTGGAGCGACATCAAGCGGAAGCTGACAAATCGTCGAACACCTCGCAGGCGTTGGAGGAGCGGGAGGAAATTGCTCGTCGCACATCTCAGTTGCCGACGTCGCCAACCATGTCTCTGCCAGTATCGCAGGCGTTGGAGGAGCGGGAGGAAATTGCTCGTCGCGCACCTCTGTTGCCGACGCCGCCAACCGCGTCTATGCCAGCCTCGACTGGCGAAATTGGTCTGGATGGCCACCGCATTTCAACTCAGTTCCGGGGGAGGGCATCGGGGGTAGTCACTACTCTCGTCCCACCTCCGGGCAAGGGTACGCACTCTCTACCATTTTCTCCTCGTGTTCATCCAAATTTTTCGGAGTTTGTTGGTCGCGAGGAGAGTGGGGGATCAGAGGGGCGTGGGTACAATCACAGATTGCCAAAATTGGATTTTCCCCAATTTGATGGCAGTGATCCTCAGAATTGGCGTTTAAGATGTGAACATTATTTTGGGGTTTATGGCACTCATCCAGATTTATGGGTTAGAGTAGCTACCATTTATTTCATTGGTCGAGCTGCATCTTGGTTACGTTCTTCGCGAGCTCATTTGCTTTGTGGGAATTGGGGAGTTTTTTGTGATACGGTGGATAGGAAGTTTGATAGGAATAGACACCTTCAGCTTGTTCGTCAGATTGATCAACTCAAGCAGTTAGGGTCGGTGAATGAGTATTATGAGCGTTTTGATGATTTGTGGAGTCAGTTGTTAGTTTATGATCCAACCTTGAGCACTGTTAATTTCTTCCCATCTTTGGTGTCCAAGGATGGGAAGAAATTGGGTGATCACGCTGCTCGAATTAAAAGTGCTTACCCTTTACCTTTACCACCACCCAAATTTGTGCATGCTGGCAAGGGAGATGATAAAAGAACAGCTGAAGTTCCTAAAGTGGCCAATTCTTCTGATAAATTGGTTGCTCTCAAGGCCTATCGACGAGCTCAAGGTCTTTGCTATGTTTGTGCTGAAAAATGGTCTCCTACTCACAAGTGTTCAGGATCAGTACAGTTACATGCTGTTCAAGAACTCTTCAGTGTTTTGGCAGCTGATGTTTCTGAGGGTGAACAGGATGCTGATTCTACCTCTAGTCTGATGGCTATTTCTTTACAGGCCATTCAAGGCACGGTTTCTGCACATACTTTGCGATTACAAGGGTCCATTCAAGGCTTTGATGTGTTAATTTTGGTGGATTCAGGCAGCTCTTGCAGTTTTCTCAGTTCAGTGGTTTTACCTCATCTTACTGGTGTGAAATCTTTACTTACTCCGGTTCAAGTAAAGGTAGCCAATGGTGCTGTTCTTTCTTGTACCTCTGAGTTGCCGGCTGCAAAATGGGAGGTTCAAGGGCATCAGTTCTCTACTGATTTCAAACTGCTTCCTTTGGACAATTATGATATGATCTTGGGTATGGACTGGTTAGAGAAATATAGTCCAATGGATATCAATTGGCAGGCCAAAACAATTCAGTTTGGTCTTCATGATAAGTCAGTGGAACTTAAAGGAGTGGTACCTGAATTGGATAAATGTGATCTGGTCTCTATTCATCAGTTACAGCTGTTGCACAATCAAGGAGCTGTGGAGTCCTTGGTTCAGCTCACTGCCAGTGACGGCTCTAGTTCTTCTCAAAATGTTCCAAGTTCAATTCAGTCCATTTTGGATGAATTTGCTGACATTTTTAATGAACCAGACGGGTTGCCACCTTCTCGATCTTATGATCACACTATTCCTTTGATTGCTGGAGCACAACCAGTCAACATTCGTCCATATCGTTATACACCTGATCAGAAGAATGAAATTGAAAAACAAGTTCAGGAAATGTTGAAAAAAGATTTGCGCTCGGGATATCATCAGATTCGCATGGCTCCTCAGGATGAACATAAGACTGCATTTAAGACCCACAATGGCCATTTTGAGTTCAGAGTTCTTCCTTTTGGTCTTACCAGTGCTCCAGCCACTTTTCAGGGTGTTATGAATTCTGTTTTAGCAGCTCAATTGCGTCAGTCTGTCTTGGTCTTTGTTGATGACATCTTAGTTTACAGCCGTTCTTTGGAAGAGCATAAGAATCATCTGAGACAAGTTTTAAGCACCTTGACACATCACCAATTGAAGGAGGCTTTTGTAGCCCTCAAGACTGCTTTGATTGAAGCTCCTGTATTGGCTTTACCTAATTTTCAGCAACCTTTTGTTGTTGAAACGGATGCATCGGACAAAGGGATTGGAGCTGTTCTTATGCAAAATGGTCATCCCATTGCATTTCTCAGTAAAGCACTTGGACCTCGCACTCAAGGCTTGTCTACCTATGAAAAGGAGAGTCTTGCAATCATGTTAGCAATTGATCATTGGCGTTCTTATTTGCAACATGACGAGTTTGTGATTAGAACGGATCATCGCAGTCTATCTTTTCTAACAAATCAGAGATTGTCGACCCCTTGGCAACAAAAAGCTTTGACTAAACTTTTAGGTCTGAGGTATAAAATCTGTTATAAGAAAGGATTGGAGAATGGGGCTGCTGATGCATTATCTCGTCGACAATCTGATGGTTTGGAGGAAGTGTCTGCCATTTCTATATGTTTGCCGGACTGGCTACAGGAGCTAATTGATGGTTATCAATCTGACTCGGAGGCTCAGAAATTACTTCAAGCTTTATCTGTGTCAGGTGCAGGTCCATCTAACTTTGAAGTGCAGAATGGCATTTTGTATTTTAAACATAGAATCTGGATTGGTCATAATAAACTTTTGCAACAAAAGATTCTGGCCAATTTACATACTGCAGCAGTGGGGGGTCATTCAGGAATTTTGGTTACTTATCAAAGAGTTAAGCAGTTGTTCTCTTGGCCAGGCATGCGCAAAGATGTTCAGGAGTTTGTTCAACATTGTGATATTTGTCAAAGAGCTAAATCTGAACATGTTAAATACCCAGGGTTATTGCAGCCATTGGAGGTACCTTCTCAGTCATGGCAAGTAATTACTATGGATTTTATTGAAGGTTTACCCAAATCAGCTTCATTTGACTGTATACTGGTTATTGTGGATAAATTCTCTAAGTTTGCTCATTTTTTACCCCTGAAACACCCCTTTACTGCCTTTGGAGTGGCTCAGCTTTTCATGGAACACATACACAGTATACATGGTTTACCTCAAGCTATTGTATCTGACCGTGATCGAGTGTTCACTAGTTCTCTTTGGAAGGAATTGTTTCGCCGAGCTGGTACTCAACTCCGAATGAGTTCGTCGTATCACCCACAATCGGATGGACAAACTGAGCGTGTGAATCAATGTGTGGAAATGTTTTTGCGCTGCTTTGTTCATTCTTGTCCTTCTCGGTGGAAGCATTGGCTGGCCTTGGCTCAATATTGGTACAATACGTCATTTCATTCAGCCTTGGGTATGACTCCTTTTGAAGTATTATTTGGACACAAACCTCGTTACTTTGGATTATCCACCTCCTCTGTTGATGCTCCTGGAGATCTTGCAACTTGGTTAAGTGAGCGAAATGACATGAATACTTTGATTCATCATCATTTGTTGCGAGCTCAGCAACGGATGAAGAGCCAAGCTGATTTGAAGCGATCTGAGCGTTGTTTTGTGGTTGGTGATTGGGTGTTCATGAAATTACAACCATATATTCAACAATCATTTATGACTCGCTCTAACAGGAAGTTATCCTTCAAATATTATGGTCCATTTCAAGTCTTACAACGAATTGGATCGGTGGCTTACAGGTTACAATTGCCTGCTCACAGCTTGATACACCCTGTTGTCCATGTGTCTCAGCTCAAGAAGGCTCTCGCACCATCTGAAGCAGTTCAGCCTTCTTTGCCTGTGTTAAATCCTGATGCTGGTCATTTGGCAATTCCAATCAAAATTCTGGATCATTGTTCGATTCGTCGAGGTTCCAAGATGATCAAGCAAGTTTTAATTCGTTGGTCCGGTGTGTCTTCTTCTGCTGACACCTGGGAGAGTTTAGATGAAATGCAAGCTAAGTTTCCAGCTGCACCAGCCTGGGGACAGGCTGAAACTCAAGGAGGGAGGAATGTTACTGCATCAATACAGAGCACTACCCATAACTCTAGTATCATTGGGCCTAGAAGATCCAAACGAGAAGTCCACACCAACCCAAAGTATATGGGCTGTGATTGGGTTACTGGTTGA


Protein sequences

Name Description Sequence
hypothetical protein Os11g0686400 [Oryza sativa (japonica cultivar-group)].

MFNLPRRLEELLCHHGSMLPKGADEEIPLIKQDLEEIISILHGHSEPKLEDHSMVVRCWMKEVRELSYDIEDSIDQYEHAARSQNRPNIHHRKFNRWRGNKIPCIPQKLKQRLWMANKIREFSLRIQDALQRHAMYNNLGGVAGTASTTRGDVCSATPWHPTKTQFREHVDNVRSVSIDVDGMEAALNDLNKLKNLLAGIPTASLVQFREHADKVRGIHTDIEAILNKLENIPPGITTTTTTTTRGDAFMESTCHVGIGAAMNKLENLLDLCGEEKLKVVSIVGVGGVGKTTLANKLYRKLRWQFECRAFVRTSQKTDMRRLLINILLQIRSHQSPDNWKVHSLISSIRTYLQDKRGCVCCLLSLISALATIRPHLAKDIPPIKGFLIVIDDLWATSTWDIIKCALPEGNKSSRILTTTEIEDLALQSCSYDLKFIFKMIPFGEDDSRKLLFSIVFGSHSKCPPEVSETLYDIVRKCGGLPLAIVTVASLLASQLDKLEQWDYINKSLGYSLMANPTLEGMKQLLNLCYNNLPQHLKACMLYLSMYQGDHIIWKDDLVNQWIAEGFICATEEHDKEEISRGYFDELVGRKIIQPVHIDDSGEVLSCVVHHIVLNFVTYKSIEENFIIAIDHSQATIRFADKVRRLSIHFNNVEDAPPPTNMRLFQVRTIAFFGVLKYMPFIMEFRLIKVLFLHFLGDEDSTGIVDLTKISELVRLRYLKVTSNATVKLPTRLQGLPYLETLKIDGKISEVPTDIYLPGLLHLTLPAKTNLPSGIVHMTSLRTIEYFDLSCNSAENLWSLGELSNLRDLQLTYSEIHSDNLKDNMKYLGSILGKLRNLTSITLSPPGSSCPDTLHIDRDTKTRINVDGWSSVSSPPALLQRFELLPCVCIFSNLPNWIGQLGNLCILKIGIREVTSNNIDVLGVLPELTVLSLYVHTKPAERIVFDNAGFSILRYFKFICSVAWMKFEVGAMPSLRKLKLGFDVHRADQHDIIPVGIEHLSGLEEISAKIRVASTAHDHCRRFAESALTNAIRMHPGRPSVNIRCVDWTFDGMDVSNAGTREGECRILKKQQNIVKESSTEKSAVLEKDRGDGANKSDESRWPSSVDPRTVTAKSDTFLVACVPLAGFECGACNEAGCKGMRLAGRQAAFMVACGHDSGQGLLDLAFPCSDSLVADGYSYANCYVVRDCLVELLATGDSREKLPMEMWHVRSNTEDDGLSWSKYEQKEILGAKFPRAYFRCTHWNTKKGCMATKEVQRDDGDPLMFDIVYHGEHTCTQTAESNVDEQIRLTRTRDKKVKRTKRKRQVRVTSVPADDGYSWRKYGQKNVLGFSYLRGYYRCATKGCQASKQVQRHDDGLLFDVTYFGEHTCADQPQAAHSSDQVQVTLWPPASTILERPTFKTRLQGQVDAMEKQHEGFRKMLSSIQEAIGAMSVKQGEVQETMNKMEKSISSWRPQVDAAVQSLQRDMELQRNQVGAVERHQAEADKSSNTSQALEEREEIARRTSQLPTSPTMSLPVSQALEEREEIARRAPLLPTPPTASMPASTGEIGLDGHRISTQFRGRASGVVTTLVPPPGKGTHSLPFSPRVHPNFSEFVGREESGGSEGRGYNHRLPKLDFPQFDGSDPQNWRLRCEHYFGVYGTHPDLWVRVATIYFIGRAASWLRSSRAHLLCGNWGVFCDTVDRKFDRNRHLQLVRQIDQLKQLGSVNEYYERFDDLWSQLLVYDPTLSTVNFFPSLVSKDGKKLGDHAARIKSAYPLPLPPPKFVHAGKGDDKRTAEVPKVANSSDKLVALKAYRRAQGLCYVCAEKWSPTHKCSGSVQLHAVQELFSVLAADVSEGEQDADSTSSLMAISLQAIQGTVSAHTLRLQGSIQGFDVLILVDSGSSCSFLSSVVLPHLTGVKSLLTPVQVKVANGAVLSCTSELPAAKWEVQGHQFSTDFKLLPLDNYDMILGMDWLEKYSPMDINWQAKTIQFGLHDKSVELKGVVPELDKCDLVSIHQLQLLHNQGAVESLVQLTASDGSSSSQNVPSSIQSILDEFADIFNEPDGLPPSRSYDHTIPLIAGAQPVNIRPYRYTPDQKNEIEKQVQEMLKKDLRSGYHQIRMAPQDEHKTAFKTHNGHFEFRVLPFGLTSAPATFQGVMNSVLAAQLRQSVLVFVDDILVYSRSLEEHKNHLRQVLSTLTHHQLKEAFVALKTALIEAPVLALPNFQQPFVVETDASDKGIGAVLMQNGHPIAFLSKALGPRTQGLSTYEKESLAIMLAIDHWRSYLQHDEFVIRTDHRSLSFLTNQRLSTPWQQKALTKLLGLRYKICYKKGLENGAADALSRRQSDGLEEVSAISICLPDWLQELIDGYQSDSEAQKLLQALSVSGAGPSNFEVQNGILYFKHRIWIGHNKLLQQKILANLHTAAVGGHSGILVTYQRVKQLFSWPGMRKDVQEFVQHCDICQRAKSEHVKYPGLLQPLEVPSQSWQVITMDFIEGLPKSASFDCILVIVDKFSKFAHFLPLKHPFTAFGVAQLFMEHIHSIHGLPQAIVSDRDRVFTSSLWKELFRRAGTQLRMSSSYHPQSDGQTERVNQCVEMFLRCFVHSCPSRWKHWLALAQYWYNTSFHSALGMTPFEVLFGHKPRYFGLSTSSVDAPGDLATWLSERNDMNTLIHHHLLRAQQRMKSQADLKRSERCFVVGDWVFMKLQPYIQQSFMTRSNRKLSFKYYGPFQVLQRIGSVAYRLQLPAHSLIHPVVHVSQLKKALAPSEAVQPSLPVLNPDAGHLAIPIKILDHCSIRRGSKMIKQVLIRWSGVSSSADTWESLDEMQAKFPAAPAWGQAETQGGRNVTASIQSTTHNSSIIGPRRSKREVHTNPKYMGCDWVTG

Domains

Domain Start-End Description Sequence

Seg: seg
185-198 seg

AALNDLNKLKNLLA

Seg: seg
237-244 seg

TTTTTTTT

superfamily: SSF52540
265-515 P-loop containing nucleoside triphosphate hydrolases

LENLLDLCGEEKLKVVSIVGVGGVGKTTLANKLYRKLRWQFECRAFVRTSQKTDMRRLLINILLQIRSHQSPDNWKVHSLISSIRTYLQDKRGCVCCLLSLISALATIRPHLAKDIPPIKGFLIVIDDLWATSTWDIIKCALPEGNKSSRILTTTEIEDLALQSCSYDLKFIFKMIPFGEDDSRKLLFSIVFGSHSKCPPEVSETLYDIVRKCGGLPLAIVTVASLLASQLDKLEQWDYINKSLGYSLMAN

HMMPfam: PF00931
IPR002182
265-569 NB-ARC,NBS
NB-ARC

LENLLDLCGEEKLKVVSIVGVGGVGKTTLANKLYRKLRWQFECRAFVRTSQKTDMRRLLINILLQIRSHQSPDNWKVHSLISSIRTYLQDKRGCVCCLLSLISALATIRPHLAKDIPPIKGFLIVIDDLWATSTWDIIKCALPEGNKSSRILTTTEIEDLALQSCSYDLKFIFKMIPFGEDDSRKLLFSIVFGSHSKCPPEVSETLYDIVRKCGGLPLAIVTVASLLASQLDKLEQWDYINKSLGYSLMANPTLEGMKQLLNLCYNNLPQHLKACMLYLSMYQGDHIIWKDDLVNQWIAEGFICA

FPrintScan: PR00364
IPR000767
279-294 DISEASERSIST
Disease resistance protein

VVSIVGVGGVGKTTLA

Seg: seg
279-289 seg

VVSIVGVGGVG

Seg: seg
320-331 seg

RRLLINILLQIR

Gene3D: G3DSA:3.40.50.300
458-459 no description

SH

FPrintScan: PR00364
IPR000767
477-491 DISEASERSIST
Disease resistance protein

CGGLPLAIVTVASLL

superfamily: SSF52047
640-1011 RNI-like,LRR

DKVRRLSIHFNNVEDAPPPTNMRLFQVRTIAFFGVLKYMPFIMEFRLIKVLFLHFLGDEDSTGIVDLTKISELVRLRYLKVTSNATVKLPTRLQGLPYLETLKIDGKISEVPTDIYLPGLLHLTLPAKTNLPSGIVHMTSLRTIEYFDLSCNSAENLWSLGELSNLRDLQLTYSEIHSDNLKDNMKYLGSILGKLRNLTSITLSPPGSSCPDTLHIDRDTKTRINVDGWSSVSSPPALLQRFELLPCVCIFSNLPNWIGQLGNLCILKIGIREVTSNNIDVLGVLPELTVLSLYVHTKPAERIVFDNAGFSILRYFKFICSVAWMKFEVGAMPSLRKLKLGFDVHRADQHDIIPVGIEHLSGLEEISAKIRV

Gene3D: G3DSA:3.80.10.10
877-1007 no description

LLQRFELLPCVCIFSNLPNWIGQLGNLCILKIGIREVTSNNIDVLGVLPELTVLSLYVHTKPAERIVFDNAGFSILRYFKFICSVAWMKFEVGAMPSLRKLKLGFDVHRADQHDIIPVGIEHLSGLEEISA

superfamily: SSF118290
IPR003657
1205-1279 WRKY DNA-binding domain
DNA-binding WRKY

EMWHVRSNTEDDGLSWSKYEQKEILGAKFPRAYFRCTHWNTKKGCMATKEVQRDDGDPLMFDIVYHGEHTCTQTA

Gene3D: G3DSA:2.20.25.80
IPR003657
1208-1277 no description
DNA-binding WRKY

HVRSNTEDDGLSWSKYEQKEILGAKFPRAYFRCTHWNTKKGCMATKEVQRDDGDPLMFDIVYHGEHTCTQ

ProfileScan: PS50811
IPR003657
1209-1273 WRKY
DNA-binding WRKY

VRSNTEDDGLSWSKYEQKEILGAKFPRAYFRCTHWNTKKGCMATKEVQRDDGDPLMFDIVYHGEH

HMMSmart: SM00774
IPR003657
1214-1277 DNA binding domain
DNA-binding WRKY

EDDGLSWSKYEQKEILGAKFPRAYFRCTHWNTKKGCMATKEVQRDDGDPLMFDIVYHGEHTCTQ

HMMPfam: PF03106
IPR003657
1215-1276 WRKY
DNA-binding WRKY

DDGLSWSKYEQKEILGAKFPRAYFRCTHWNTKKGCMATKEVQRDDGDPLMFDIVYHGEHTCT

Seg: seg
1288-1311 seg

RLTRTRDKKVKRTKRKRQVRVTSV

Gene3D: G3DSA:2.20.25.80
IPR003657
1301-1370 no description
DNA-binding WRKY

KRKRQVRVTSVPADDGYSWRKYGQKNVLGFSYLRGYYRCATKGCQASKQVQRHDDGLLFDVTYFGEHTCA

superfamily: SSF118290
IPR003657
1304-1373 WRKY DNA-binding domain
DNA-binding WRKY

RQVRVTSVPADDGYSWRKYGQKNVLGFSYLRGYYRCATKGCQASKQVQRHDDGLLFDVTYFGEHTCADQP

HMMSmart: SM00774
IPR003657
1313-1371 DNA binding domain
DNA-binding WRKY

ADDGYSWRKYGQKNVLGFSYLRGYYRCATKGCQASKQVQRHDDGLLFDVTYFGEHTCAD

HMMPfam: PF03106
IPR003657
1314-1370 WRKY
DNA-binding WRKY

DDGYSWRKYGQKNVLGFSYLRGYYRCATKGCQASKQVQRHDDGLLFDVTYFGEHTCA

ProfileScan: PS50811
IPR003657
1314-1367 WRKY
DNA-binding WRKY

DDGYSWRKYGQKNVLGFSYLRGYYRCATKGCQASKQVQRHDDGLLFDVTYFGEH

Coil: coil
1477-1498 coiled-coil

VERHQAEADKSSNTSQALEERE

Seg: seg
1520-1545 seg

ALEEREEIARRAPLLPTPPTASMPAS

HMMPanther: PTHR10178
1590-2728 FAMILY NOT NAMED,GAG/POL/ENV POLYPROTEIN

PNFSEFVGREESGGSEGRGYNHRLPKLDFPQFDGSDPQNWRLRCEHYFGVYGTHPDLWVRVATIYFIGRAASWLRSSRAHLLCGNWGVFCDTVDRKFDRNRHLQLVRQIDQLKQLGSVNEYYERFDDLWSQLLVYDPTLSTVNFFPSLVSKDGKKLGDHAARIKSAYPLPLPPPKFVHAGKGDDKRTAEVPKVANSSDKLVALKAYRRAQGLCYVCAEKWSPTHKCSGSVQLHAVQELFSVLAADVSEGEQDADSTSSLMAISLQAIQGTVSAHTLRLQGSIQGFDVLILVDSGSSCSFLSSVVLPHLTGVKSLLTPVQVKVANGAVLSCTSELPAAKWEVQGHQFSTDFKLLPLDNYDMILGMDWLEKYSPMDINWQAKTIQFGLHDKSVELKGVVPELDKCDLVSIHQLQLLHNQGAVESLVQLTASDGSSSSQNVPSSIQSILDEFADIFNEPDGLPPSRSYDHTIPLIAGAQPVNIRPYRYTPDQKNEIEKQVQEMLKKDLRSGYHQIRMAPQDEHKTAFKTHNGHFEFRVLPFGLTSAPATFQGVMNSVLAAQLRQSVLVFVDDILVYSRSLEEHKNHLRQVLSTLTHHQLKEAFVALKTALIEAPVLALPNFQQPFVVETDASDKGIGAVLMQNGHPIAFLSKALGPRTQGLSTYEKESLAIMLAIDHWRSYLQHDEFVIRTDHRSLSFLTNQRLSTPWQQKALTKLLGLRYKICYKKGLENGAADALSRRQSDGLEEVSAISICLPDWLQELIDGYQSDSEAQKLLQALSVSGAGPSNFEVQNGILYFKHRIWIGHNKLLQQKILANLHTAAVGGHSGILVTYQRVKQLFSWPGMRKDVQEFVQHCDICQRAKSEHVKYPGLLQPLEVPSQSWQVITMDFIEGLPKSASFDCILVIVDKFSKFAHFLPLKHPFTAFGVAQLFMEHIHSIHGLPQAIVSDRDRVFTSSLWKELFRRAGTQLRMSSSYHPQSDGQTERVNQCVEMFLRCFVHSCPSRWKHWLALAQYWYNTSFHSALGMTPFEVLFGHKPRYFGLSTSSVDAPGDLATWLSERNDMNTLIHHHLLRAQQRMKSQADLKRSERCFVVGDWVFMKLQPYIQQSFMTRSNRKLSFKYYGPFQVLQRIGSVAYRLQLP

HMMPanther: PTHR10178:SF14
1590-2728 RETROVIRUS POLYPROTEIN,RETROVIRUS POLYPROTEIN

PNFSEFVGREESGGSEGRGYNHRLPKLDFPQFDGSDPQNWRLRCEHYFGVYGTHPDLWVRVATIYFIGRAASWLRSSRAHLLCGNWGVFCDTVDRKFDRNRHLQLVRQIDQLKQLGSVNEYYERFDDLWSQLLVYDPTLSTVNFFPSLVSKDGKKLGDHAARIKSAYPLPLPPPKFVHAGKGDDKRTAEVPKVANSSDKLVALKAYRRAQGLCYVCAEKWSPTHKCSGSVQLHAVQELFSVLAADVSEGEQDADSTSSLMAISLQAIQGTVSAHTLRLQGSIQGFDVLILVDSGSSCSFLSSVVLPHLTGVKSLLTPVQVKVANGAVLSCTSELPAAKWEVQGHQFSTDFKLLPLDNYDMILGMDWLEKYSPMDINWQAKTIQFGLHDKSVELKGVVPELDKCDLVSIHQLQLLHNQGAVESLVQLTASDGSSSSQNVPSSIQSILDEFADIFNEPDGLPPSRSYDHTIPLIAGAQPVNIRPYRYTPDQKNEIEKQVQEMLKKDLRSGYHQIRMAPQDEHKTAFKTHNGHFEFRVLPFGLTSAPATFQGVMNSVLAAQLRQSVLVFVDDILVYSRSLEEHKNHLRQVLSTLTHHQLKEAFVALKTALIEAPVLALPNFQQPFVVETDASDKGIGAVLMQNGHPIAFLSKALGPRTQGLSTYEKESLAIMLAIDHWRSYLQHDEFVIRTDHRSLSFLTNQRLSTPWQQKALTKLLGLRYKICYKKGLENGAADALSRRQSDGLEEVSAISICLPDWLQELIDGYQSDSEAQKLLQALSVSGAGPSNFEVQNGILYFKHRIWIGHNKLLQQKILANLHTAAVGGHSGILVTYQRVKQLFSWPGMRKDVQEFVQHCDICQRAKSEHVKYPGLLQPLEVPSQSWQVITMDFIEGLPKSASFDCILVIVDKFSKFAHFLPLKHPFTAFGVAQLFMEHIHSIHGLPQAIVSDRDRVFTSSLWKELFRRAGTQLRMSSSYHPQSDGQTERVNQCVEMFLRCFVHSCPSRWKHWLALAQYWYNTSFHSALGMTPFEVLFGHKPRYFGLSTSSVDAPGDLATWLSERNDMNTLIHHHLLRAQQRMKSQADLKRSERCFVVGDWVFMKLQPYIQQSFMTRSNRKLSFKYYGPFQVLQRIGSVAYRLQLP

Seg: seg
1597-1608 seg

GREESGGSEGRG

HMMPfam: PF03732
IPR005162
1650-1721 Retrotrans_gag
Retrotransposon gag protein

VATIYFIGRAASWLRSSRAHLLCGNWGVFCDTVDRKFDRNRHLQLVRQIDQLKQLGSVNEYYERFDDLWSQL

superfamily: SSF50630
IPR021109
1855-1962 Acid proteases
Peptidase aspartic

AIQGTVSAHTLRLQGSIQGFDVLILVDSGSSCSFLSSVVLPHLTGVKSLLTPVQVKVANGAVLSCTSELPAAKWEVQGHQFSTDFKLLPLDNYDMILGMDWLEKYSPM

HMMPfam: PF08284
IPR013242
1875-1971 RVP_2
Retroviral aspartyl protease

DVLILVDSGSSCSFLSSVVLPHLTGVKSLLTPVQVKVANGAVLSCTSELPAAKWEVQGHQFSTDFKLLPLDNYDMILGMDWLEKYSPMDINWQAKTI

PatternScan: PS00141
IPR001969
1878-1889 ASP_PROTEASE
Peptidase aspartic, active site

ILVDSGSSCSFL

Seg: seg
1879-1894 seg

LVDSGSSCSFLSSVVL

Seg: seg
2018-2033 seg

SDGSSSSQNVPSSIQS

superfamily: SSF56672
2033-2312 DNA/RNA polymerases

SILDEFADIFNEPDGLPPSRSYDHTIPLIAGAQPVNIRPYRYTPDQKNEIEKQVQEMLKKDLRSGYHQIRMAPQDEHKTAFKTHNGHFEFRVLPFGLTSAPATFQGVMNSVLAAQLRQSVLVFVDDILVYSRSLEEHKNHLRQVLSTLTHHQLKEAFVALKTALIEAPVLALPNFQQPFVVETDASDKGIGAVLMQNGHPIAFLSKALGPRTQGLSTYEKESLAIMLAIDHWRSYLQHDEFVIRTDHRSLSFLTNQRLSTPWQQKALTKLLGLRYKICYK

HMMPfam: PF00078
IPR000477
2069-2185 RVT_1
Reverse transcriptase

IRPYRYTPDQKNEIEKQVQEMLKKDLRSGYHQIRMAPQDEHKTAFKTHNGHFEFRVLPFGLTSAPATFQGVMNSVLAAQLRQSVLVFVDDILVYSRSLEEHKNHLRQVLSTLTHHQL

Gene3D: G3DSA:3.30.70.270
2083-2186 no description

EKQVQEMLKKDLRSGYHQIRMAPQDEHKTAFKTHNGHFEFRVLPFGLTSAPATFQGVMNSVLAAQLRQSVLVFVDDILVYSRSLEEHKNHLRQVLSTLTHHQLK

ProfileScan: PS50994
IPR001584
2461-2623 INTEGRASE
Integrase, catalytic core

PLEVPSQSWQVITMDFIEGLPKSASFDCILVIVDKFSKFAHFLPLKHPFTAFGVAQLFMEHIHSIHGLPQAIVSDRDRVFTSSLWKELFRRAGTQLRMSSSYHPQSDGQTERVNQCVEMFLRCFVHSCPSRWKHWLALAQYWYNTSFHSALGMTPFEVLFGHK

superfamily: SSF53098
IPR012337
2461-2629 Ribonuclease H-like
Ribonuclease H-like domain

PLEVPSQSWQVITMDFIEGLPKSASFDCILVIVDKFSKFAHFLPLKHPFTAFGVAQLFMEHIHSIHGLPQAIVSDRDRVFTSSLWKELFRRAGTQLRMSSSYHPQSDGQTERVNQCVEMFLRCFVHSCPSRWKHWLALAQYWYNTSFHSALGMTPFEVLFGHKPRYFGL

Gene3D: G3DSA:3.30.420.10
2463-2616 no description

EVPSQSWQVITMDFIEGLPKSASFDCILVIVDKFSKFAHFLPLKHPFTAFGVAQLFMEHIHSIHGLPQAIVSDRDRVFTSSLWKELFRRAGTQLRMSSSYHPQSDGQTERVNQCVEMFLRCFVHSCPSRWKHWLALAQYWYNTSFHSALGMTPF

HMMPfam: PF00665
IPR001584
2465-2577 rve
Integrase, catalytic core

PSQSWQVITMDFIEGLPKSASFDCILVIVDKFSKFAHFLPLKHPFTAFGVAQLFMEHIHSIHGLPQAIVSDRDRVFTSSLWKELFRRAGTQLRMSSSYHPQSDGQTERVNQCV

superfamily: SSF54160
IPR016197
2730-2810 Chromo domain-like
Chromo domain-like

HSLIHPVVHVSQLKKALAPSEAVQPSLPVLNPDAGHLAIPIKILDHCSIRRGSKMIKQVLIRWSGVSSSADTWESLDEMQA

HMMPfam: PF00385
IPR023780
2768-2820 Chromo
Chromo domain

IPIKILDHCSIRRGSKMIKQVLIRWSGVSSSADTWESLDEMQAKFPAAPAWGQ


List of References


The map-based sequence of the rice genome.
Nature: 2005, 436(7052);793-800
PubMed:16100779 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox