PRGDB00049880 (Os11g0684200)

From PRG Wiki
Jump to: navigation, search
Os11g0684200
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 115486648 (NM_001075000)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa (japonica cultivar-group) Os11g0684200 (Os11g0684200) mRNA, complete cds.

DNA Sequence

ATGGGGAAGCTGTTCATGGTGCTGGAGAACCAGTACAACAAGCACAAGGTCCTCGAGCAAGAAATCAGCTCCCTCCAGCAAGAGTTCCGCATGATTGCCGCCGTCATGGACGACCAGCTCCTTTCTATGGGCAGGAGCGAAGCACGCACATCTGTTGCATGGCTGCACAACGAGGAGATGCTCGATCTTGAGCATGACATTGAGGACTGCGTCGACCGTTTCATGCACCTCCTCACCTGCAAGCATCATCGTGGTGGGGTGCGCCAGATGGCACATGAGGTAAAGATCCGCTCGAGCTTCAGTGAAGAGATCCAGAAGCTCAGGAGGCGCCTCAGTGAGGTGCGCCATCTGGTGGGCATTAGGCAGCCCATGGAGGAGCTCCTCTCGCTGCTAGATGAAGTGGAGGGCGAGCCAAAGCAGTTGAGGGTGACCTCCATCGTGGGGTTCAGTGGCTTGGGGAAGACCACCCTCGCCAAGGCGGTCTACGATAGCCCTCATGCAAAGGATAAATTCTGCCTCCGTGCGTGGATCACCGCTGATGGCTCACCGGAAACGAGCAATTGGATGAAGGAGATCCTGCGCGGTGTACTCCAGCAAGTGCGTCCCGGCGATGCCATGGATGTCGATGGCCAGCATCTTGAAGCCTCGCTCAAGGAGTACCTCAAGGACAAGAGGTATTTAATTATCATCGATGACATCAGGATGGATCAATGGAGGATCATAAGTTCAGCCTTTGAAAATAATGGTACAGGCAGCAGGATATTACTTACCACAACTATTCAGTCAGTAACTAATAGGTGCAGCCATGGCAATGGTTATGTGTATCAAATGAACACACTTGGTAAAGAAGACTCTGAGGAACTAGCTTTTTCAGTGCTTAGATCACCTGAGTTGGAGAACCATTCAGAATCATTACTAGGGAAATGTGATGGTCTTCCTCTTGCTCTGGTCAGTGTCTCTGATTATCTGAAGAGCTCAACTGAGGCAACGGGAGAGTTGTGTGCAAAGCTATGCCGTGATCTGGGTTCTCATCTGACAGGAAACCATGGCCATGACAACTTTTCAGAACTCAGGAAGGTGCTTCTTGGCAACTATGACAGTTTTTCCGGCTCTGCTCTGAGTTGCTTGCTGTATCTTGGTATATTCCCAAACAATCATCCTCTCAGGAAGAAAGTTCTAATCCGGCGGTGGTTAGCTGAAGGAAACGCAAGAAGTGATGACCCTTGGCGCAGTGAAGAGGACACTGCAGATGACAATTTCAGTAACCTTATTGACCAGAATATCATTCAGCCAGTTGACACAAGAAACAATTCTGAAGTGAAGACGTGCAAAACTCATGGAATTATGCATGAATTTTTGCTGAACAGGTCCTTGGCCAAGAGATTCATCACGACATCACCGCATGATCCAAGAGTTGGAATCAATACTACCAATTCACGCCACCTTTCTGTTGATGCTGCTAAACAGACAAAATGCATGGCATCTGACGAGGAATTATCTCGAGTCCGATCTCTGACAATCTTTGGGGATGCAGGTGATGCAATTTCTTATCTTCACAAGTGCAATCTGATACGAGTCTTGGATCTACAAGAATGCAGTGATTTGAACGATAATCATCTGAAACGCATATGTGTACTGTCACCGTGGCATCTGAAATACCTGAACCTTGGGGGCAATATCAGTGAGCTTCCAAGGAGTATTGAAGGGCTGCATTGTTTAGAGACACTGGATTTAAGGGAAACAGAGATAAAGTTTTTGCCCATTGAAGGTATCATGCTGCCCCACTTAGCTCACTTGTTTGGAAAGTTTATGCTTCACAAAGATGATCTGAACAATGTGAAGAAGATAAGTAAACTATTAAAATTGTTTTCATCAAATAAAAGCAACTTGCAAACTTTAGCAGGATTTATCACTGACGGGAGGAAAGGATTTCTTCAACTTATTGGTCATATGAAAAAACTGAGGAAGGTTAAGATATGGTGCAGGCATGTTGAAGGTAGCAGTAATTACATTGCTGATCTTTCAAAGGCCATTCAGGAATTTACCAAGGCTCCCATTGACATGGACAGAGTCCGTTCTCTCTCAATTGATTCCGAAGAATACTGTGAAAAATTCCTAAGTTCACTTGATTTGGAGCCATGCTCTGAATATTCGAAATACCATCTAAGTTCACTAAAGATACATGGCAAGTTACTCCGGTTGCCTCCATTTTTTAGTTCTTTGTCAGGTCTCATTGATCTGTGTATTACACCAGCTACTCTGACACAAGATCATCTATCAGCACTGATAAATCTGAACAGACTGCTGTACCTCAAACTGATTGCTGACAAGCTCGAGAATTTAGAGATAAAACATGAAGCACTACTGAGCCTGAGACGCCTGTGCTTTGTGGTGAAAAGTGTGGCGTTAGCGCAGCCAAAAATCGAGCAAGGAGCTCTACCAAACCTTGTTTCACTTCAGCTGCTCTGTCAAGGACTAGTTGGTCTTTCCGGCATCGAGATCAGACACCTGAAAAATCTCAAGGAAGTTACGATTGACTCTGGAGTGACTGCGCAAACAAGGCAAGATTGGGAACAAGCTGCAAAGAACCACCCTAACAGGCCTAGAGTTTTGTTGCTCGGAAAGGTTGATCCAGTGGAAAGCGAGGAACCGGGAAGACCCTGTGCCATAAGGGGGAGGGGGAAAAGTTCTATAGGCCAAGAAAGTTCAGAAGATGGTTCAGATTCTAGCCTTAAGAGGATGAGACTTGCAGAGCCTTCTTCTTCTTCGCAGCTTCAGGTGACCGGCCATCCGCATCCGGTGGTGGTAGCAGCCACCGAAGCAGCATCCCAGCCTTCCATGGCAAATCTCTAG


Protein sequences

Name Description Sequence
hypothetical protein Os11g0684200 [Oryza sativa (japonica cultivar-group)].

MGKLFMVLENQYNKHKVLEQEISSLQQEFRMIAAVMDDQLLSMGRSEARTSVAWLHNEEMLDLEHDIEDCVDRFMHLLTCKHHRGGVRQMAHEVKIRSSFSEEIQKLRRRLSEVRHLVGIRQPMEELLSLLDEVEGEPKQLRVTSIVGFSGLGKTTLAKAVYDSPHAKDKFCLRAWITADGSPETSNWMKEILRGVLQQVRPGDAMDVDGQHLEASLKEYLKDKRYLIIIDDIRMDQWRIISSAFENNGTGSRILLTTTIQSVTNRCSHGNGYVYQMNTLGKEDSEELAFSVLRSPELENHSESLLGKCDGLPLALVSVSDYLKSSTEATGELCAKLCRDLGSHLTGNHGHDNFSELRKVLLGNYDSFSGSALSCLLYLGIFPNNHPLRKKVLIRRWLAEGNARSDDPWRSEEDTADDNFSNLIDQNIIQPVDTRNNSEVKTCKTHGIMHEFLLNRSLAKRFITTSPHDPRVGINTTNSRHLSVDAAKQTKCMASDEELSRVRSLTIFGDAGDAISYLHKCNLIRVLDLQECSDLNDNHLKRICVLSPWHLKYLNLGGNISELPRSIEGLHCLETLDLRETEIKFLPIEGIMLPHLAHLFGKFMLHKDDLNNVKKISKLLKLFSSNKSNLQTLAGFITDGRKGFLQLIGHMKKLRKVKIWCRHVEGSSNYIADLSKAIQEFTKAPIDMDRVRSLSIDSEEYCEKFLSSLDLEPCSEYSKYHLSSLKIHGKLLRLPPFFSSLSGLIDLCITPATLTQDHLSALINLNRLLYLKLIADKLENLEIKHEALLSLRRLCFVVKSVALAQPKIEQGALPNLVSLQLLCQGLVGLSGIEIRHLKNLKEVTIDSGVTAQTRQDWEQAAKNHPNRPRVLLLGKVDPVESEEPGRPCAIRGRGKSSIGQESSEDGSDSSLKRMRLAEPSSSSQLQVTGHPHPVVVAATEAASQPSMANL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF268
1-897 PTHR23155:SF268,SUBFAMILY NOT NAMED

MGKLFMVLENQYNKHKVLEQEISSLQQEFRMIAAVMDDQLLSMGRSEARTSVAWLHNEEMLDLEHDIEDCVDRFMHLLTCKHHRGGVRQMAHEVKIRSSFSEEIQKLRRRLSEVRHLVGIRQPMEELLSLLDEVEGEPKQLRVTSIVGFSGLGKTTLAKAVYDSPHAKDKFCLRAWITADGSPETSNWMKEILRGVLQQVRPGDAMDVDGQHLEASLKEYLKDKRYLIIIDDIRMDQWRIISSAFENNGTGSRILLTTTIQSVTNRCSHGNGYVYQMNTLGKEDSEELAFSVLRSPELENHSESLLGKCDGLPLALVSVSDYLKSSTEATGELCAKLCRDLGSHLTGNHGHDNFSELRKVLLGNYDSFSGSALSCLLYLGIFPNNHPLRKKVLIRRWLAEGNARSDDPWRSEEDTADDNFSNLIDQNIIQPVDTRNNSEVKTCKTHGIMHEFLLNRSLAKRFITTSPHDPRVGINTTNSRHLSVDAAKQTKCMASDEELSRVRSLTIFGDAGDAISYLHKCNLIRVLDLQECSDLNDNHLKRICVLSPWHLKYLNLGGNISELPRSIEGLHCLETLDLRETEIKFLPIEGIMLPHLAHLFGKFMLHKDDLNNVKKISKLLKLFSSNKSNLQTLAGFITDGRKGFLQLIGHMKKLRKVKIWCRHVEGSSNYIADLSKAIQEFTKAPIDMDRVRSLSIDSEEYCEKFLSSLDLEPCSEYSKYHLSSLKIHGKLLRLPPFFSSLSGLIDLCITPATLTQDHLSALINLNRLLYLKLIADKLENLEIKHEALLSLRRLCFVVKSVALAQPKIEQGALPNLVSLQLLCQGLVGLSGIEIRHLKNLKEVTIDSGVTAQTRQDWEQAAKNHPNRPRVLLLGKVDPVESEEPGRPCAIRGRGKSS

HMMPanther: PTHR23155
1-897 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

MGKLFMVLENQYNKHKVLEQEISSLQQEFRMIAAVMDDQLLSMGRSEARTSVAWLHNEEMLDLEHDIEDCVDRFMHLLTCKHHRGGVRQMAHEVKIRSSFSEEIQKLRRRLSEVRHLVGIRQPMEELLSLLDEVEGEPKQLRVTSIVGFSGLGKTTLAKAVYDSPHAKDKFCLRAWITADGSPETSNWMKEILRGVLQQVRPGDAMDVDGQHLEASLKEYLKDKRYLIIIDDIRMDQWRIISSAFENNGTGSRILLTTTIQSVTNRCSHGNGYVYQMNTLGKEDSEELAFSVLRSPELENHSESLLGKCDGLPLALVSVSDYLKSSTEATGELCAKLCRDLGSHLTGNHGHDNFSELRKVLLGNYDSFSGSALSCLLYLGIFPNNHPLRKKVLIRRWLAEGNARSDDPWRSEEDTADDNFSNLIDQNIIQPVDTRNNSEVKTCKTHGIMHEFLLNRSLAKRFITTSPHDPRVGINTTNSRHLSVDAAKQTKCMASDEELSRVRSLTIFGDAGDAISYLHKCNLIRVLDLQECSDLNDNHLKRICVLSPWHLKYLNLGGNISELPRSIEGLHCLETLDLRETEIKFLPIEGIMLPHLAHLFGKFMLHKDDLNNVKKISKLLKLFSSNKSNLQTLAGFITDGRKGFLQLIGHMKKLRKVKIWCRHVEGSSNYIADLSKAIQEFTKAPIDMDRVRSLSIDSEEYCEKFLSSLDLEPCSEYSKYHLSSLKIHGKLLRLPPFFSSLSGLIDLCITPATLTQDHLSALINLNRLLYLKLIADKLENLEIKHEALLSLRRLCFVVKSVALAQPKIEQGALPNLVSLQLLCQGLVGLSGIEIRHLKNLKEVTIDSGVTAQTRQDWEQAAKNHPNRPRVLLLGKVDPVESEEPGRPCAIRGRGKSS

superfamily: SSF52540
105-325 SSF52540

QKLRRRLSEVRHLVGIRQPMEELLSLLDEVEGEPKQLRVTSIVGFSGLGKTTLAKAVYDSPHAKDKFCLRAWITADGSPETSNWMKEILRGVLQQVRPGDAMDVDGQHLEASLKEYLKDKRYLIIIDDIRMDQWRIISSAFENNGTGSRILLTTTIQSVTNRCSHGNGYVYQMNTLGKEDSEELAFSVLRSPELENHSESLLGKCDGLPLALVSVSDYLKS

Gene3D: G3DSA:3.40.50.300
122-235 G3DSA:3.40.50.300

QPMEELLSLLDEVEGEPKQLRVTSIVGFSGLGKTTLAKAVYDSPHAKDKFCLRAWITADGSPETSNWMKEILRGVLQQVRPGDAMDVDGQHLEASLKEYLKDKRYLIIIDDIRM

HMMPfam: PF00931
IPR002182
122-405 NB-ARC,NBS
NB-ARC

QPMEELLSLLDEVEGEPKQLRVTSIVGFSGLGKTTLAKAVYDSPHAKDKFCLRAWITADGSPETSNWMKEILRGVLQQVRPGDAMDVDGQHLEASLKEYLKDKRYLIIIDDIRMDQWRIISSAFENNGTGSRILLTTTIQSVTNRCSHGNGYVYQMNTLGKEDSEELAFSVLRSPELENHSESLLGKCDGLPLALVSVSDYLKSSTEATGELCAKLCRDLGSHLTGNHGHDNFSELRKVLLGNYDSFSGSALSCLLYLGIFPNNHPLRKKVLIRRWLAEGNARS

FPrintScan: PR00364
IPR000767
143-158 DISEASERSIST
Disease resistance protein

VTSIVGFSGLGKTTLA

FPrintScan: PR00364
IPR000767
220-234 DISEASERSIST
Disease resistance protein

YLKDKRYLIIIDDIR

FPrintScan: PR00364
IPR000767
309-323 DISEASERSIST
Disease resistance protein

CDGLPLALVSVSDYL

superfamily: SSF52058
444-847 SSF52058,LRR

KTHGIMHEFLLNRSLAKRFITTSPHDPRVGINTTNSRHLSVDAAKQTKCMASDEELSRVRSLTIFGDAGDAISYLHKCNLIRVLDLQECSDLNDNHLKRICVLSPWHLKYLNLGGNISELPRSIEGLHCLETLDLRETEIKFLPIEGIMLPHLAHLFGKFMLHKDDLNNVKKISKLLKLFSSNKSNLQTLAGFITDGRKGFLQLIGHMKKLRKVKIWCRHVEGSSNYIADLSKAIQEFTKAPIDMDRVRSLSIDSEEYCEKFLSSLDLEPCSEYSKYHLSSLKIHGKLLRLPPFFSSLSGLIDLCITPATLTQDHLSALINLNRLLYLKLIADKLENLEIKHEALLSLRRLCFVVKSVALAQPKIEQGALPNLVSLQLLCQGLVGLSGIEIRHLKNLKEVTIDS

Gene3D: G3DSA:3.80.10.10
476-633 G3DSA:3.80.10.10

TTNSRHLSVDAAKQTKCMASDEELSRVRSLTIFGDAGDAISYLHKCNLIRVLDLQECSDLNDNHLKRICVLSPWHLKYLNLGGNISELPRSIEGLHCLETLDLRETEIKFLPIEGIMLPHLAHLFGKFMLHKDDLNNVKKISKLLKLFSSNKSNLQTL

FPrintScan: PR00364
IPR000767
519-535 DISEASERSIST
Disease resistance protein

HKCNLIRVLDLQECSDL


List of References




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox