PRGDB00049881 (Os11g0684100)

From PRG Wiki
Jump to: navigation, search
Os11g0684100
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 115486646 (NM_001074999)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa (japonica cultivar-group) Os11g0684100 (Os11g0684100) mRNA, complete cds.

DNA Sequence

ATGGAGGGCTCCATGTTCAACCTCCCAGGAAGGCTCGACCGGCTCCTGCGTCGTCATGGCAGCATGCTGCCCAAGGGGGCAGAGGAGGAGATACCTCTCATCAAGCAAGATCTCGAGGAAATAATCTCCGTCCTCCATGGTCACTGTAGCAAGCCAAAGCTGGAGGACCATGCCATGGTGGTCAGGTGCTGGATGAAGGAGGTACGTGAGCTCTCTTATGACATCGAGGATTGCATCGACCAGTATGAGCATGCCGCCACTGCCACCCGGTCACATACTGGACCTAATATTTGTCGCCGTAAGTTCAATCAGCGGCATGGAAAGATGATCCCTTGGGTTCCCTGGAAACTTAAGCAGCGGTTGTGGATGGCCAACAAGATCAGAGAATTCAGCCTGCGCACCCAGGAGGCGCTTCAACGCCACACCATGTACAACAACCTTGGTGGCATCACCATTGCTTCTACTACTGGAGGAGATGTATGCTCTGCAACACCTTGGCATCCCACGCAGTTCAGAGAGCACACCGACAACGTCTGTTCTGTCGGTATAGACGCCGATGGTATGGAAGCTGCCCTGAATGACCTGAACAAGCTCAAAAACTTGCTCGCTAGTATCCCGACTGCTTCTCTCGTGCAGTTCAGGGAGCACGCCAATAAAGTGCGTCATATCCACCCCGATGTGGAAGCCATCCTGAACAAGCTCAAAAACATACCCACTGGTATCACCACTACTTCTACTACCACTAGAGGTGATGTATCTTCTACCTCATCTAGGCAACCCACGCGGTTCATGGAGTCCGCGGGTCTTGTTGGCATCAACGCCGCGGTGAACAAGCTTGAAAACTTGCTCGATGTGTGCGGAGAGGAGAAGCTCAAGGTGGTGTCCATCGTGGGAGTTGGAGGAGTTGGCAAGACTACGCTCGCCAACAAGCTGTACTGCAAGCTTCAGCGGCAGTTCGAGTGCTGGGCATTTGTGCAGACATCTCAGAAGACTGATATGAGGAGGCTTCTCATCAATATCCTCTCACAGGTTCAGCCGCACCAGTCACCTGACAATTGGAAGGTGCATAGCCTAATTTCCAGTATCAGGACACATCTGCAAGATAAGAGGTACTTGATCATAATTGATGGTTTATGGGCTACATCCACATGGGATGTTATTAAGTGCGCTTTGCCGGATGGTAATAGTTCCAGCAGAATACTAACCACAACAGAAATTGAGGATCTAGCTTTGCAATCTTGTAGTTATGACTTGAAATTTATTTTCAAGATGAAACCTTTTGGTGAGGGTGACTCAAGAAAACTATTTTTCAGTATAGTCTTTGGCTCTCATTCTAAGTGTCCTCCAGAAGTCAGTGAAACATTATATGATATTGTAAGGAAATGTGGTGGTTTGCCGCTAGCTATTGTCACTGTTGCTAGTCTTTTAGCAAGCCAGCTTGAGAAACAAGAACAATTGGATTATATAAACAAATCCTTAGGTTACGGTTTGATGGCAAATCCTACTTTGGAAGGGATGAAACAACTACTGAACATTTGTTACAACAATCTTCCTCAGCATTTGAAGGTATGCATGTTGTATCTTAGTATGTATCAAGAAGATCACATAATTTGGAAAGATGATTTAGTGAGTCAATGGATAGCTGAAGGTTTTATCTGTGCAACTGAAGGGCATGACAAGGAAGAAATTTCAAGGGCCTATTTTGATGAGCTTGTGGGCAGAAAAATCATCCAGCCTGTACATATCGATGACAGTGGTGAGGTTTTGTCCTGTGTAGTTCACCATATGGTACTCAATTTCGTTACATACAAGTCAATAGAAGAAAATTTTATTATTGCAATAGACCATTCACAGGCAACTATAAGATTTGCTGACAAGGTTCGACGATTATCTATCCACTTTAGTAACGTAGAAGATGCAACTCCGCCTACCAGTATGAGATTGTCCCAAGTTCGGACAGTTGCCTTCTTCGGGGTCTTGAAGTATATGCCTTTCGTTATGGAGTTTCGACTTATTAAAGTTCTAGTTCTACATATTTTGGGTGATGAGGATAGCATCGGCATTTTTGATCTCACTAAAATTTCAGAACTTGTTCGACTGAGATATTTGAAGGTCACCTCTAATGTCACCGTAAAACTGCCAACCCAGATGCAAGGTCTACCATATTTGGAGACACTGAAAATAGATGGGACAATAAGTGAAGTTCCAACAGACATTTATTTGCCACGTTTGCTGCATCTTACTCTTCCTGCTAAGACAAACCTGCCCAGTGGAATTGTCCACATGACATCGCTTCGTACAATTGGATATTTTGATCTCAGCTGTAACTCAGCGGAGAATCTATGGAGCCTTGGTGAGCTGAGCAATCTCCGGGATTTGCAGCTCACCTATTCTGAAATACATTCTGACAATCTGAAGGATAATATGAAATATCTTGGATCCATTCTGGGGAAACTCCGTAATCTCACATCTATAACTTTATCGCCTCCTGGCTCTTCCTGTCCAGATACTCTACATATTGACAGGACGAGGATCAATGTTGATGGCTGGAGCAGTGTGTCCTCTCCACCAGCCCTTCTTCAGAGGTTTGAGTTGTTACCATGTGTTTGCATCTTTTCTAACCTCCCAAATTGGATTGGGCAGCTTGGAAACCTCTGCATTTTGAAGATTGGGATAAGGGAAGTAACAAGTAATAGTATTGATGTTCTAGGAGTATTACCGAAACTCACTGTTTTGTCACTTTATGTCCACACAAAGCCTGCAGAAAGGATTGTCTTTGACAATGCAGGGTTCTCAATCCTCAAATACTTCGAGTTTATATGCAGTGTAGCATGGATGAAATTTGAGATGGGTGCAATGCCTAGTCTAAGGAAGCTCAAGCTAGGTTTTGATGTCCATATAGCAGATCAGCATGATATTATTCCTGTTGGCATCGAACATCTGTCTGGACTTGAAGAGATCTCTGCAAAAATTAGGGTCGCCTGTACTGCTCATGATCATTGTAGAAGATTTGCAGAGTCAGCTTTGACTAACGCCTTTATGATGCATCCAGGACGTCCTAGCGTCAACATACGGTGTGTGGATTGGACCTTTCATGATAAGGATAATGACTGTGTGGGGACACGAGAGGAAGAATGTAGGACTCCAATGAAACAGGAGCATTTTGTGAAAGAAGACTTAAGTGAGAAATCTGCAGTTCTACAAAACGAGCACGACGAAGAAGCACATAAATTTGTTGACAGAAGATATTATCCCATCATGGACGCGGCAGAGATCCGCAGGTGTCCGTGGAGCGTCAACGAGGAGCAGGAGCAGCCGGTGTTGATCTACGACGCCAGAACCAAGATCTCCCAGTCGTCGTCCATGCACAGCGAATTCTGGGCGGCCGTCCAACGGCTCACCGGCCCAGCTGCCACGCCGGCCAAGACCAAGAGGCACCTCCACCTGACGACCTCGCCTGAGCTGGAGGACGGCTTCTTGCCGGTACGTAGTCTCGTCTTCCCGTCCGCTCCGGATCCACGGTGCAACATGAAGAAGAAGAAGATGAGGGCCGGCCCTGGAGGGGGTCGAGCAGTGCGGTCAAACTGGGCCCCCAAATCGTAG


Protein sequences

Name Description Sequence
hypothetical protein Os11g0684100 [Oryza sativa (japonica cultivar-group)].

MEGSMFNLPGRLDRLLRRHGSMLPKGAEEEIPLIKQDLEEIISVLHGHCSKPKLEDHAMVVRCWMKEVRELSYDIEDCIDQYEHAATATRSHTGPNICRRKFNQRHGKMIPWVPWKLKQRLWMANKIREFSLRTQEALQRHTMYNNLGGITIASTTGGDVCSATPWHPTQFREHTDNVCSVGIDADGMEAALNDLNKLKNLLASIPTASLVQFREHANKVRHIHPDVEAILNKLKNIPTGITTTSTTTRGDVSSTSSRQPTRFMESAGLVGINAAVNKLENLLDVCGEEKLKVVSIVGVGGVGKTTLANKLYCKLQRQFECWAFVQTSQKTDMRRLLINILSQVQPHQSPDNWKVHSLISSIRTHLQDKRYLIIIDGLWATSTWDVIKCALPDGNSSSRILTTTEIEDLALQSCSYDLKFIFKMKPFGEGDSRKLFFSIVFGSHSKCPPEVSETLYDIVRKCGGLPLAIVTVASLLASQLEKQEQLDYINKSLGYGLMANPTLEGMKQLLNICYNNLPQHLKVCMLYLSMYQEDHIIWKDDLVSQWIAEGFICATEGHDKEEISRAYFDELVGRKIIQPVHIDDSGEVLSCVVHHMVLNFVTYKSIEENFIIAIDHSQATIRFADKVRRLSIHFSNVEDATPPTSMRLSQVRTVAFFGVLKYMPFVMEFRLIKVLVLHILGDEDSIGIFDLTKISELVRLRYLKVTSNVTVKLPTQMQGLPYLETLKIDGTISEVPTDIYLPRLLHLTLPAKTNLPSGIVHMTSLRTIGYFDLSCNSAENLWSLGELSNLRDLQLTYSEIHSDNLKDNMKYLGSILGKLRNLTSITLSPPGSSCPDTLHIDRTRINVDGWSSVSSPPALLQRFELLPCVCIFSNLPNWIGQLGNLCILKIGIREVTSNSIDVLGVLPKLTVLSLYVHTKPAERIVFDNAGFSILKYFEFICSVAWMKFEMGAMPSLRKLKLGFDVHIADQHDIIPVGIEHLSGLEEISAKIRVACTAHDHCRRFAESALTNAFMMHPGRPSVNIRCVDWTFHDKDNDCVGTREEECRTPMKQEHFVKEDLSEKSAVLQNEHDEEAHKFVDRRYYPIMDAAEIRRCPWSVNEEQEQPVLIYDARTKISQSSSMHSEFWAAVQRLTGPAATPAKTKRHLHLTTSPELEDGFLPVRSLVFPSAPDPRCNMKKKKMRAGPGGGRAVRSNWAPKS

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF196
2-961 PTHR23155:SF196,OS11G0225300 PROTEIN

EGSMFNLPGRLDRLLRRHGSMLPKGAEEEIPLIKQDLEEIISVLHGHCSKPKLEDHAMVVRCWMKEVRELSYDIEDCIDQYEHAATATRSHTGPNICRRKFNQRHGKMIPWVPWKLKQRLWMANKIREFSLRTQEALQRHTMYNNLGGITIASTTGGDVCSATPWHPTQFREHTDNVCSVGIDADGMEAALNDLNKLKNLLASIPTASLVQFREHANKVRHIHPDVEAILNKLKNIPTGITTTSTTTRGDVSSTSSRQPTRFMESAGLVGINAAVNKLENLLDVCGEEKLKVVSIVGVGGVGKTTLANKLYCKLQRQFECWAFVQTSQKTDMRRLLINILSQVQPHQSPDNWKVHSLISSIRTHLQDKRYLIIIDGLWATSTWDVIKCALPDGNSSSRILTTTEIEDLALQSCSYDLKFIFKMKPFGEGDSRKLFFSIVFGSHSKCPPEVSETLYDIVRKCGGLPLAIVTVASLLASQLEKQEQLDYINKSLGYGLMANPTLEGMKQLLNICYNNLPQHLKVCMLYLSMYQEDHIIWKDDLVSQWIAEGFICATEGHDKEEISRAYFDELVGRKIIQPVHIDDSGEVLSCVVHHMVLNFVTYKSIEENFIIAIDHSQATIRFADKVRRLSIHFSNVEDATPPTSMRLSQVRTVAFFGVLKYMPFVMEFRLIKVLVLHILGDEDSIGIFDLTKISELVRLRYLKVTSNVTVKLPTQMQGLPYLETLKIDGTISEVPTDIYLPRLLHLTLPAKTNLPSGIVHMTSLRTIGYFDLSCNSAENLWSLGELSNLRDLQLTYSEIHSDNLKDNMKYLGSILGKLRNLTSITLSPPGSSCPDTLHIDRTRINVDGWSSVSSPPALLQRFELLPCVCIFSNLPNWIGQLGNLCILKIGIREVTSNSIDVLGVLPKLTVLSLYVHTKPAERIVFDNAGFSILKYFEFICSVAWMKFEMGAMPSLRKLKL

HMMPanther: PTHR23155
2-961 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

EGSMFNLPGRLDRLLRRHGSMLPKGAEEEIPLIKQDLEEIISVLHGHCSKPKLEDHAMVVRCWMKEVRELSYDIEDCIDQYEHAATATRSHTGPNICRRKFNQRHGKMIPWVPWKLKQRLWMANKIREFSLRTQEALQRHTMYNNLGGITIASTTGGDVCSATPWHPTQFREHTDNVCSVGIDADGMEAALNDLNKLKNLLASIPTASLVQFREHANKVRHIHPDVEAILNKLKNIPTGITTTSTTTRGDVSSTSSRQPTRFMESAGLVGINAAVNKLENLLDVCGEEKLKVVSIVGVGGVGKTTLANKLYCKLQRQFECWAFVQTSQKTDMRRLLINILSQVQPHQSPDNWKVHSLISSIRTHLQDKRYLIIIDGLWATSTWDVIKCALPDGNSSSRILTTTEIEDLALQSCSYDLKFIFKMKPFGEGDSRKLFFSIVFGSHSKCPPEVSETLYDIVRKCGGLPLAIVTVASLLASQLEKQEQLDYINKSLGYGLMANPTLEGMKQLLNICYNNLPQHLKVCMLYLSMYQEDHIIWKDDLVSQWIAEGFICATEGHDKEEISRAYFDELVGRKIIQPVHIDDSGEVLSCVVHHMVLNFVTYKSIEENFIIAIDHSQATIRFADKVRRLSIHFSNVEDATPPTSMRLSQVRTVAFFGVLKYMPFVMEFRLIKVLVLHILGDEDSIGIFDLTKISELVRLRYLKVTSNVTVKLPTQMQGLPYLETLKIDGTISEVPTDIYLPRLLHLTLPAKTNLPSGIVHMTSLRTIGYFDLSCNSAENLWSLGELSNLRDLQLTYSEIHSDNLKDNMKYLGSILGKLRNLTSITLSPPGSSCPDTLHIDRTRINVDGWSSVSSPPALLQRFELLPCVCIFSNLPNWIGQLGNLCILKIGIREVTSNSIDVLGVLPKLTVLSLYVHTKPAERIVFDNAGFSILKYFEFICSVAWMKFEMGAMPSLRKLKL

superfamily: SSF52540
252-500 SSF52540

VSSTSSRQPTRFMESAGLVGINAAVNKLENLLDVCGEEKLKVVSIVGVGGVGKTTLANKLYCKLQRQFECWAFVQTSQKTDMRRLLINILSQVQPHQSPDNWKVHSLISSIRTHLQDKRYLIIIDGLWATSTWDVIKCALPDGNSSSRILTTTEIEDLALQSCSYDLKFIFKMKPFGEGDSRKLFFSIVFGSHSKCPPEVSETLYDIVRKCGGLPLAIVTVASLLASQLEKQEQLDYINKSLGYGLMAN

HMMPfam: PF00931
IPR002182
276-554 NB-ARC,NBS
NB-ARC

VNKLENLLDVCGEEKLKVVSIVGVGGVGKTTLANKLYCKLQRQFECWAFVQTSQKTDMRRLLINILSQVQPHQSPDNWKVHSLISSIRTHLQDKRYLIIIDGLWATSTWDVIKCALPDGNSSSRILTTTEIEDLALQSCSYDLKFIFKMKPFGEGDSRKLFFSIVFGSHSKCPPEVSETLYDIVRKCGGLPLAIVTVASLLASQLEKQEQLDYINKSLGYGLMANPTLEGMKQLLNICYNNLPQHLKVCMLYLSMYQEDHIIWKDDLVSQWIAEGFICA

Gene3D: G3DSA:3.40.50.300
290-318 G3DSA:3.40.50.300

KLKVVSIVGVGGVGKTTLANKLYCKLQRQ

FPrintScan: PR00364
IPR000767
293-308 DISEASERSIST
Disease resistance protein

VVSIVGVGGVGKTTLA

FPrintScan: PR00364
IPR000767
365-379 DISEASERSIST
Disease resistance protein

HLQDKRYLIIIDGLW

FPrintScan: PR00364
IPR000767
462-476 DISEASERSIST
Disease resistance protein

CGGLPLAIVTVASLL

superfamily: SSF52047
625-993 SSF52047,LRR

DKVRRLSIHFSNVEDATPPTSMRLSQVRTVAFFGVLKYMPFVMEFRLIKVLVLHILGDEDSIGIFDLTKISELVRLRYLKVTSNVTVKLPTQMQGLPYLETLKIDGTISEVPTDIYLPRLLHLTLPAKTNLPSGIVHMTSLRTIGYFDLSCNSAENLWSLGELSNLRDLQLTYSEIHSDNLKDNMKYLGSILGKLRNLTSITLSPPGSSCPDTLHIDRTRINVDGWSSVSSPPALLQRFELLPCVCIFSNLPNWIGQLGNLCILKIGIREVTSNSIDVLGVLPKLTVLSLYVHTKPAERIVFDNAGFSILKYFEFICSVAWMKFEMGAMPSLRKLKLGFDVHIADQHDIIPVGIEHLSGLEEISAKIRV

Gene3D: G3DSA:3.80.10.10
693-804 G3DSA:3.80.10.10

KISELVRLRYLKVTSNVTVKLPTQMQGLPYLETLKIDGTISEVPTDIYLPRLLHLTLPAKTNLPSGIVHMTSLRTIGYFDLSCNSAENLWSLGELSNLRDLQLTYSEIHSDN

FPrintScan: PR00364
IPR000767
785-801 DISEASERSIST
Disease resistance protein

GELSNLRDLQLTYSEIH

Gene3D: G3DSA:3.80.10.10
876-914 G3DSA:3.80.10.10

PNWIGQLGNLCILKIGIREVTSNSIDVLGVLPKLTVLSL


List of References




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox