PRGDB00049882 (Os11g0673600)

From PRG Wiki
Jump to: navigation, search
Os11g0673600
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 115486596 (NM_001074974)
Gene Class CNL
Domain Type LRR, NBS, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa (japonica cultivar-group) Os11g0673600 (Os11g0673600) mRNA, complete cds.

DNA Sequence

ATGGCAACAATAGTGGATACTTTGGTTGGATCATGCATCAATAAGTTGCAAGCGATCATTACAGACAAGGCAATACTCATTTTAGGGGTAAAAGATGAGCTTGAAGAACTGCAGCGAAGAACAGATCTCATAAGATATTCTCTTCAGGATGCTGAGGCAAGGAGGATGAAAGATTCTGCAGTTCAAAAATGGCTTGACCAGCTAAGAGATGTTATGTATGATGTTGATGATATTATTGATTTGGCTAGATTTAAAGGAAGTGTCCTACTACCTAACTATCCTATGTCATCGTCAAGGAAATCTACTGCTTGCAGTGGCCTTTCACTTTCATCCTGCTTTTCTAATATTCGTATACGTCATGAAGTTGCTGTAAAAATTAGAAGCCTGAACAAAAAGATAGATAACATTTCAAAGGATGATGTATTTTTAAAACTCAGCCTCACACAACATAATGGAAGTGGTTCAGCATGGACACCTATAGAAAGCTCCAGCCTAGTTGAACCTAACCTTGTGGGCAAGGAGGTCGTACATGCTTGCAGAGAAGTGGTGGATTTGGTGCTTGCACACAAGGCAAAGAATGTTTACAAGCTTGCTATTGTTGGAACAGGGGGAGTTGGCAAGACAACACTAGCTCAGAAAATATTCAATGATAAAAAATTAGAAGGGAGATTTGACCATCGTGCCTGGGTTTGTGTCTCCAAGGAGTATTCTATGGTTTCCCTTTTGGCACAAGTTCTTAGTAATATGAAAATTCATTATGAAAAAAATGAATCAGTTGGGAACCTTCAAAGCAAACTCAAAGCAGGCATTGCAGACAAGAGTTTTTTCCTTGTGTTGGATGATGTATGGCACTATAAAGCATGGGAAGATTTACTAAGAACTCCACTAAATGCGGCAGCCACAGGAATAATTCTAGTAACTACTCGAGATGAAACTATTGCTCGTGTAATTGGGGTGGACCGCACTCATAGAGTTGATTTGATGTCAGCCGATATAGGATGGGAGTTACTTTGGAGGAGCATGCAACATCAAAGAAGAGAAACAAGTGAAAAATCTACGGGACACAGGGCTATTGCCAAAGTCTTAGCAAGCCTGCAAGATCAAACAGAGAATGAGTGGAGACAGATATTGGGGAAAAATGCCTGGTCCATGAGCAAACTTCCTGATGAATTAAATGGTGCTTTATATCTGAGTTATGAAGTGCTGCCGCACCAGCTGAAGCAATGTTTTCTTTATTGTGCACTTTTCCCTGAAGATGCAACCATTTTCTGTGGTGATCTTACTAGGATGTGGGTGGCTGAAGGCTTTATAGATGAGCAAGAAGGCCAATTATTAGAAGACACAGCAGAGAGGTGCAAGATGCATGATCTCTTAAGGCAACTTGCTTCTTATTTGTCAAGAGAAGAATGTTTTGTTGGAGACCCAGAGTCACTAGGGACTAATACTATGTGCAAAGTACGGCGTATTTCAGTTGTCACTGAGAAGGACATAGTGGTGTTACCTAGCATGGACAAGGATCAATATAAAGTGAGGACAAATATATGTTCTCTCCCAGAGGCCATTGGCTCCCTTCAAAGCCTTCAAATATTGAATTTGCAGGGGACAGATGAAGCATATTCAGAGGAAGGCATTAGCAATGTTGAGAAGATCTTTGAGAAGCTAGAACCTCCACACAACTTAGAAGATCTTGTTATCGGGGATTTCTTTGGGCGAAGGTTCCCCACCTGGCTTGGTAGTACCCATTTGTCTTCAGTGAAATACGTGCTCCTCATAGATTGCAAATCTTGTGTGCATCTTCCCCCAATCGGACAGCTACCAAACTTGAAATACCTAAAAATTAATGGAGCAAGTGCAATCACCAAGATTGGACCCGAATTTGTTGGCTGCTGGGAGGGTAATCTCAGATCCACAGAGGCAGTTGCTTTCCCCAAGCTCGAATGGTTGGTCATCAAGGATATGCCCAAATGGGAGGAGTGGTCCTTTGTTGAAGAAGAAGAAGTGCAGGAGGAAGCAGCTGCAGCAGCCAAGGAAGGGGGAGAGGATGGAATTGCTGCTTCGAAGCAAAAGGGGGAGGAAGCCCCGTCTCCAACTCCAAGGTCGTCGTGGCTGCTGCCTTGTTTGACGAAGTTGGATCTCGTGGGCTGCCCCAAGCTGAGGGCTCTCCCACCACAGCTTGGACAGCAGGCCACCAACTTGAAGAAACTCTTTATAAGAGACACAAGATACTTGAAGACGGTGGAGGACCTCCCGTTCCTCTCTGGTGGCCTTCAAGTTGAAGGATGTGAAGGACTGGAGAGGGTCTCCAACCTTCCCCAAGTGAGAGAGCTGTTTGTAAATGAATGCCCGAATTTGAGGCATGTCGAGGAGTTGGGTGGTTTGGAGCAGCTATGGCTGGATGAAGGTATGCAGGAGATCTCTTCACTGTGGGTCCCAAGGCTTCAGGAGCAACACCGCCAGCTCCATGGAGATGAGCATGAGCTGGAGGTCACCGAGTGGCTCTGA


Protein sequences

Name Description Sequence
hypothetical protein Os11g0673600 [Oryza sativa (japonica cultivar-group)].

MATIVDTLVGSCINKLQAIITDKAILILGVKDELEELQRRTDLIRYSLQDAEARRMKDSAVQKWLDQLRDVMYDVDDIIDLARFKGSVLLPNYPMSSSRKSTACSGLSLSSCFSNIRIRHEVAVKIRSLNKKIDNISKDDVFLKLSLTQHNGSGSAWTPIESSSLVEPNLVGKEVVHACREVVDLVLAHKAKNVYKLAIVGTGGVGKTTLAQKIFNDKKLEGRFDHRAWVCVSKEYSMVSLLAQVLSNMKIHYEKNESVGNLQSKLKAGIADKSFFLVLDDVWHYKAWEDLLRTPLNAAATGIILVTTRDETIARVIGVDRTHRVDLMSADIGWELLWRSMQHQRRETSEKSTGHRAIAKVLASLQDQTENEWRQILGKNAWSMSKLPDELNGALYLSYEVLPHQLKQCFLYCALFPEDATIFCGDLTRMWVAEGFIDEQEGQLLEDTAERCKMHDLLRQLASYLSREECFVGDPESLGTNTMCKVRRISVVTEKDIVVLPSMDKDQYKVRTNICSLPEAIGSLQSLQILNLQGTDEAYSEEGISNVEKIFEKLEPPHNLEDLVIGDFFGRRFPTWLGSTHLSSVKYVLLIDCKSCVHLPPIGQLPNLKYLKINGASAITKIGPEFVGCWEGNLRSTEAVAFPKLEWLVIKDMPKWEEWSFVEEEEVQEEAAAAAKEGGEDGIAASKQKGEEAPSPTPRSSWLLPCLTKLDLVGCPKLRALPPQLGQQATNLKKLFIRDTRYLKTVEDLPFLSGGLQVEGCEGLERVSNLPQVRELFVNECPNLRHVEELGGLEQLWLDEGMQEISSLWVPRLQEQHRQLHGDEHELEVTEWL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF230
5-784 OS11G0674500 PROTEIN,OS11G0674500 PROTEIN

VDTLVGSCINKLQAIITDKAILILGVKDELEELQRRTDLIRYSLQDAEARRMKDSAVQKWLDQLRDVMYDVDDIIDLARFKGSVLLPNYPMSSSRKSTACSGLSLSSCFSNIRIRHEVAVKIRSLNKKIDNISKDDVFLKLSLTQHNGSGSAWTPIESSSLVEPNLVGKEVVHACREVVDLVLAHKAKNVYKLAIVGTGGVGKTTLAQKIFNDKKLEGRFDHRAWVCVSKEYSMVSLLAQVLSNMKIHYEKNESVGNLQSKLKAGIADKSFFLVLDDVWHYKAWEDLLRTPLNAAATGIILVTTRDETIARVIGVDRTHRVDLMSADIGWELLWRSMQHQRRETSEKSTGHRAIAKVLASLQDQTENEWRQILGKNAWSMSKLPDELNGALYLSYEVLPHQLKQCFLYCALFPEDATIFCGDLTRMWVAEGFIDEQEGQLLEDTAERCKMHDLLRQLASYLSREECFVGDPESLGTNTMCKVRRISVVTEKDIVVLPSMDKDQYKVRTNICSLPEAIGSLQSLQILNLQGTDEAYSEEGISNVEKIFEKLEPPHNLEDLVIGDFFGRRFPTWLGSTHLSSVKYVLLIDCKSCVHLPPIGQLPNLKYLKINGASAITKIGPEFVGCWEGNLRSTEAVAFPKLEWLVIKDMPKWEEWSFVEEEEVQEEAAAAAKEGGEDGIAASKQKGEEAPSPTPRSSWLLPCLTKLDLVGCPKLRALPPQLGQQATNLKKLFIRDTRYLKTVEDLPFLSGGLQVEGCEGLERVSNLPQVRELFVNECPNL

HMMPanther: PTHR23155
5-784 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

VDTLVGSCINKLQAIITDKAILILGVKDELEELQRRTDLIRYSLQDAEARRMKDSAVQKWLDQLRDVMYDVDDIIDLARFKGSVLLPNYPMSSSRKSTACSGLSLSSCFSNIRIRHEVAVKIRSLNKKIDNISKDDVFLKLSLTQHNGSGSAWTPIESSSLVEPNLVGKEVVHACREVVDLVLAHKAKNVYKLAIVGTGGVGKTTLAQKIFNDKKLEGRFDHRAWVCVSKEYSMVSLLAQVLSNMKIHYEKNESVGNLQSKLKAGIADKSFFLVLDDVWHYKAWEDLLRTPLNAAATGIILVTTRDETIARVIGVDRTHRVDLMSADIGWELLWRSMQHQRRETSEKSTGHRAIAKVLASLQDQTENEWRQILGKNAWSMSKLPDELNGALYLSYEVLPHQLKQCFLYCALFPEDATIFCGDLTRMWVAEGFIDEQEGQLLEDTAERCKMHDLLRQLASYLSREECFVGDPESLGTNTMCKVRRISVVTEKDIVVLPSMDKDQYKVRTNICSLPEAIGSLQSLQILNLQGTDEAYSEEGISNVEKIFEKLEPPHNLEDLVIGDFFGRRFPTWLGSTHLSSVKYVLLIDCKSCVHLPPIGQLPNLKYLKINGASAITKIGPEFVGCWEGNLRSTEAVAFPKLEWLVIKDMPKWEEWSFVEEEEVQEEAAAAAKEGGEDGIAASKQKGEEAPSPTPRSSWLLPCLTKLDLVGCPKLRALPPQLGQQATNLKKLFIRDTRYLKTVEDLPFLSGGLQVEGCEGLERVSNLPQVRELFVNECPNL

Coil: coil
34-55 coiled-coil

LEELQRRTDLIRYSLQDAEARR

superfamily: SSF52540
158-386 P-loop containing nucleoside triphosphate hydrolases

TPIESSSLVEPNLVGKEVVHACREVVDLVLAHKAKNVYKLAIVGTGGVGKTTLAQKIFNDKKLEGRFDHRAWVCVSKEYSMVSLLAQVLSNMKIHYEKNESVGNLQSKLKAGIADKSFFLVLDDVWHYKAWEDLLRTPLNAAATGIILVTTRDETIARVIGVDRTHRVDLMSADIGWELLWRSMQHQRRETSEKSTGHRAIAKVLASLQDQTENEWRQILGKNAWSMSK

Gene3D: G3DSA:3.40.50.300
177-315 no description

HACREVVDLVLAHKAKNVYKLAIVGTGGVGKTTLAQKIFNDKKLEGRFDHRAWVCVSKEYSMVSLLAQVLSNMKIHYEKNESVGNLQSKLKAGIADKSFFLVLDDVWHYKAWEDLLRTPLNAAATGIILVTTRDETIAR

HMMPfam: PF00931
IPR002182
187-440 NB-ARC,NBS
NB-ARC

LAHKAKNVYKLAIVGTGGVGKTTLAQKIFNDKKLEGRFDHRAWVCVSKEYSMVSLLAQVLSNMKIHYEKNESVGNLQSKLKAGIADKSFFLVLDDVWHYKAWEDLLRTPLNAAATGIILVTTRDETIARVIGVDRTHRVDLMSADIGWELLWRSMQHQRRETSEKSTGHRAIAKVLASLQDQTENEWRQILGKNAWSMSKLPDELNGALYLSYEVLPHQLKQCFLYCALFPEDATIFCGDLTRMWVAEGFIDEQ

FPrintScan: PR00364
IPR000767
196-211 DISEASERSIST
Disease resistance protein

KLAIVGTGGVGKTTLA

FPrintScan: PR00364
IPR000767
269-283 DISEASERSIST
Disease resistance protein

GIADKSFFLVLDDVW

superfamily: SSF52058
453-796 L domain-like,LRR

KMHDLLRQLASYLSREECFVGDPESLGTNTMCKVRRISVVTEKDIVVLPSMDKDQYKVRTNICSLPEAIGSLQSLQILNLQGTDEAYSEEGISNVEKIFEKLEPPHNLEDLVIGDFFGRRFPTWLGSTHLSSVKYVLLIDCKSCVHLPPIGQLPNLKYLKINGASAITKIGPEFVGCWEGNLRSTEAVAFPKLEWLVIKDMPKWEEWSFVEEEEVQEEAAAAAKEGGEDGIAASKQKGEEAPSPTPRSSWLLPCLTKLDLVGCPKLRALPPQLGQQATNLKKLFIRDTRYLKTVEDLPFLSGGLQVEGCEGLERVSNLPQVRELFVNECPNLRHVEELGGLEQL

Gene3D: G3DSA:3.80.10.10
514-652 no description

ICSLPEAIGSLQSLQILNLQGTDEAYSEEGISNVEKIFEKLEPPHNLEDLVIGDFFGRRFPTWLGSTHLSSVKYVLLIDCKSCVHLPPIGQLPNLKYLKINGASAITKIGPEFVGCWEGNLRSTEAVAFPKLEWLVIKD

FPrintScan: PR00364
IPR000767
522-538 DISEASERSIST
Disease resistance protein

GSLQSLQILNLQGTDEA

Seg: seg
657-685 seg

EEWSFVEEEEVQEEAAAAAKEGGEDGIAA

Gene3D: G3DSA:3.80.10.10
703-801 no description

LLPCLTKLDLVGCPKLRALPPQLGQQATNLKKLFIRDTRYLKTVEDLPFLSGGLQVEGCEGLERVSNLPQVRELFVNECPNLRHVEELGGLEQLWLDEG


List of References




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox