PRGDB00049884 (Os11g0657900)

From PRG Wiki
Jump to: navigation, search
Os11g0657900
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 115486508 (NM_001074930)
Gene Class NL
Domain Type LRR, NBS, LRR, LRR, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa (japonica cultivar-group) Os11g0657900 (Os11g0657900) mRNA, complete cds.

DNA Sequence

ATGGAGCTCGCCATGGGTGCCATAGGCAGCGTGCTCCCAAGGCTAGCTGAGCTTCTCAAGGAGGAGTACAAGCTACAGAAGGGCGTCAAGAACGACGTCGAGTCCCTCTCCCGGGAGCTCGCAGCGATGCACATCGCCCTCGAGAGAGTTGCCAAGGTTCCAAGGGAGATGGTAGAGCTCGATGTCAAGCTCTGGGCCTCTAATGTCAGGGAGCTATCATATGCCATCGAGGATGCCATCGACGCCTTTGTCGTGCGTGTCGCAGAGGGCAGCAACCTTGTCGATCCTATCAACCAGGGATTCTTCAAGAGGATCCTTCGCAAGACGAGTGATCTGATCAGGAAAGGGAAAGCTCGCCGTGAGATCGCCGAAGGGATCTGTGACATCAAGGAGCTTGCAGATGAGGTGGCAGAGCTGCGAGCAAGGTACAAGTTCGATGCAGCAGCTGCTGCAACGACTCCGGCTACGGCCACCGTGGATCCCCGGATCCTTGCTCTTTACAAGGATATCACAGAGCTTGTTGGCATCGAAGAGGCCAGAGATGAGCTGATCGGCATGTTGTCTAGGCCTGCAGACGACGACCAACTGAATATCGTGTCCGTTGTTGGATTTGGAGGATTGGGCAAGACGACTCTTGCTAAGGTTGTGTATGACAAGCTCAGAGGCCAATTCGACTGCGCGGCTTTTGTTTCGGTGGGTCAAAATCCTGACTTGAAGAAAGTTTTGACGGACATGATATATGACCTTGATAGGCAGCGGTATATTAGCATTCATAACTCAAGGATGGATGAACGCCTCCTTATTAATGAACTTCGAGATTTTGTTCAGAACAAAAGGTACATCATCATAATTGATGATATATGGGATGAAAAACTGTGGGAATATATCAAGTGTGCTTTCTACAGAAACAAGCTTTGCAGTCGAATAATAACCACGACACGCAAAGTTACAGTTTCTAAAGCATGTTGCTCTCATGATGATGCAATTTATAGGATGAAGCCTCTTTCTGATGATGCCTCCAAAAGGCTATTCTACAAAAGGATATTTAAGCATGATAATGGGTGTCCTCCAGAACTGGAACAAGTATCAATAGGTATATTGAAGAAATGTGCTGGGATGCCGTTAGCCATTATAACTATAGCTAGTCTCTTAGCCAACAAGCAGGTACAAACAAGGGATCAATGGCATGATGTGTTTAATTCTATTGGTCGCGGACTTACCGAAGAGCCCAAGGTTGAGGACATGACAAAGATATTGTCTTTTAGCTATTATGATCTACCGTGTCACCTCAAGACATGTTTACTGTATCTAAGTATATTTCCAGAAGATTTTATAATTAGTAGAGACCATTTGGTACGGATGTGGATAGCCGAAGGTGTTGTCCAAAAAACAACAAATCAAAAGGACGATGTGCTGGTTGAGCTAGGAGAGAATTATTTCTATGAGCTCATAAATAGAAGCATGATTCAACCTTGGGATGAAAATGACTTTATGTATTACAAAGATGGGTATGACAACGCAATAATATCTTGTCGAGTGCATGACATGGTGCTTGACCTCATCCTTTCCCTCTCAAATGAGGAGAATTTTGTTACCATATTGGATCAGGAGCGAGGCGCATCTTCACTCAGTAAAGCTCACCGGATATCCCTCCGAGATTGCAATGTAGTGCACACTATACCAGAGGCTACTGTGCCAAAAGTAAGGTTCCTCTCTCTTCTTCGCGCAGATGTTCATATGACGCCGGCAATTACAATCTTTCCAATTTTACGTGTGTTGGATTTATATAATTGTCATTTTGAGGAGAGCTACCACCTTAAGCATCTTGGGAACTTATTTCACCTAAGGTACCTGAGACTACACTGTGGATGTATCACTAAGCTCCCAAATGAGATAGGAAATCTTCAGTTTTTGCAGACTCTAGACGTGCATAGAAGTCGTAGTATAAAAGAACTGCCACCGGCTATTTATCAGCTAAGAAGATTGATGTTCCTATATTTTCCTGAAAATATATCACTGTCAGACAGGATTGGTGAATTGACATCACTGCTGGAGTTGTCCCCGGTAGATGTTTTTCGAAGAACATCCTCTATTGATGTTAATGGTGACTCCTTCAGCTTGCTAAAAGCATTGGGTAACCTGACAGAACTAAGAGATCTTACAATTCAGGTGTGGTCGTCTGAGGTCTCGAGCATCGGGAGAATTCTCGGTGAGGTATTGTGCAATCTACACAAACTCCGCCGTCTAATTCTGCGGGGAGTACATGGAATCGTCCATTTGGATTCCCTACCAGAGTTCTTGGACCTTCCCCAACACATTCATGTACTTGGGATAAAACCCATGTATTTCTTCACTGTACTACCTGTGTGGTTCAATTTCCCGATAGATCTCCCATACCTTTCCTTTCTGGACTTGTCCATCTGCGACATGCGTCAGGAGCATGTCGAGAAACTTGGGAGGTTGCCGGCTCTTCAGGTTCTTTGGATACAGATCAACAGAGAAAGTGAATGGCTTGTGATTGGCGCTGGTGCATTCCCATCTCTGACAGACTGCACATTCATTCAATATTGTGGGCTGGTGTTCCAACCAGGAGCAATGCCAAAGGTTAGAAAACTGGAGTTCAACATCAACGTGGTAGATTCTGAGGATATCAATTTTGATGTTGGCTTGGGGAACCTGGCTTCGATCGAGGAAGTCACCATTGATCTGTTGTGTGAGGATGCTGTAGAATGGGAGGTGGAGGAGGTTGAGAATGTGCTGAGGCACGTAGCCGACATCCATCCCAAGCATCCAACCCTTGAAATGCGCAGATCGGATGAAGATAAAATGGTCTTGGATGATGAAGAGGAGCAACAGTCAGAGGATCCTATGGAAGACTCCGACATGGAAGAAAACAGGGCACCAGACAGCATGGCCAGTGAAAGTTCTTGA


Protein sequences

Name Description Sequence
hypothetical protein Os11g0657900 [Oryza sativa (japonica cultivar-group)].

MELAMGAIGSVLPRLAELLKEEYKLQKGVKNDVESLSRELAAMHIALERVAKVPREMVELDVKLWASNVRELSYAIEDAIDAFVVRVAEGSNLVDPINQGFFKRILRKTSDLIRKGKARREIAEGICDIKELADEVAELRARYKFDAAAAATTPATATVDPRILALYKDITELVGIEEARDELIGMLSRPADDDQLNIVSVVGFGGLGKTTLAKVVYDKLRGQFDCAAFVSVGQNPDLKKVLTDMIYDLDRQRYISIHNSRMDERLLINELRDFVQNKRYIIIIDDIWDEKLWEYIKCAFYRNKLCSRIITTTRKVTVSKACCSHDDAIYRMKPLSDDASKRLFYKRIFKHDNGCPPELEQVSIGILKKCAGMPLAIITIASLLANKQVQTRDQWHDVFNSIGRGLTEEPKVEDMTKILSFSYYDLPCHLKTCLLYLSIFPEDFIISRDHLVRMWIAEGVVQKTTNQKDDVLVELGENYFYELINRSMIQPWDENDFMYYKDGYDNAIISCRVHDMVLDLILSLSNEENFVTILDQERGASSLSKAHRISLRDCNVVHTIPEATVPKVRFLSLLRADVHMTPAITIFPILRVLDLYNCHFEESYHLKHLGNLFHLRYLRLHCGCITKLPNEIGNLQFLQTLDVHRSRSIKELPPAIYQLRRLMFLYFPENISLSDRIGELTSLLELSPVDVFRRTSSIDVNGDSFSLLKALGNLTELRDLTIQVWSSEVSSIGRILGEVLCNLHKLRRLILRGVHGIVHLDSLPEFLDLPQHIHVLGIKPMYFFTVLPVWFNFPIDLPYLSFLDLSICDMRQEHVEKLGRLPALQVLWIQINRESEWLVIGAGAFPSLTDCTFIQYCGLVFQPGAMPKVRKLEFNINVVDSEDINFDVGLGNLASIEEVTIDLLCEDAVEWEVEEVENVLRHVADIHPKHPTLEMRRSDEDKMVLDDEEEQQSEDPMEDSDMEENRAPDSMASESS

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
4-948 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

AMGAIGSVLPRLAELLKEEYKLQKGVKNDVESLSRELAAMHIALERVAKVPREMVELDVKLWASNVRELSYAIEDAIDAFVVRVAEGSNLVDPINQGFFKRILRKTSDLIRKGKARREIAEGICDIKELADEVAELRARYKFDAAAAATTPATATVDPRILALYKDITELVGIEEARDELIGMLSRPADDDQLNIVSVVGFGGLGKTTLAKVVYDKLRGQFDCAAFVSVGQNPDLKKVLTDMIYDLDRQRYISIHNSRMDERLLINELRDFVQNKRYIIIIDDIWDEKLWEYIKCAFYRNKLCSRIITTTRKVTVSKACCSHDDAIYRMKPLSDDASKRLFYKRIFKHDNGCPPELEQVSIGILKKCAGMPLAIITIASLLANKQVQTRDQWHDVFNSIGRGLTEEPKVEDMTKILSFSYYDLPCHLKTCLLYLSIFPEDFIISRDHLVRMWIAEGVVQKTTNQKDDVLVELGENYFYELINRSMIQPWDENDFMYYKDGYDNAIISCRVHDMVLDLILSLSNEENFVTILDQERGASSLSKAHRISLRDCNVVHTIPEATVPKVRFLSLLRADVHMTPAITIFPILRVLDLYNCHFEESYHLKHLGNLFHLRYLRLHCGCITKLPNEIGNLQFLQTLDVHRSRSIKELPPAIYQLRRLMFLYFPENISLSDRIGELTSLLELSPVDVFRRTSSIDVNGDSFSLLKALGNLTELRDLTIQVWSSEVSSIGRILGEVLCNLHKLRRLILRGVHGIVHLDSLPEFLDLPQHIHVLGIKPMYFFTVLPVWFNFPIDLPYLSFLDLSICDMRQEHVEKLGRLPALQVLWIQINRESEWLVIGAGAFPSLTDCTFIQYCGLVFQPGAMPKVRKLEFNINVVDSEDINFDVGLGNLASIEEVTIDLLCEDAVEWEVEEVENVLRHVADIHPKHPTLEMRRSDEDKMVLDDE

HMMPanther: PTHR23155:SF217
4-948 PTHR23155:SF217,OS11G0657900 PROTEIN

AMGAIGSVLPRLAELLKEEYKLQKGVKNDVESLSRELAAMHIALERVAKVPREMVELDVKLWASNVRELSYAIEDAIDAFVVRVAEGSNLVDPINQGFFKRILRKTSDLIRKGKARREIAEGICDIKELADEVAELRARYKFDAAAAATTPATATVDPRILALYKDITELVGIEEARDELIGMLSRPADDDQLNIVSVVGFGGLGKTTLAKVVYDKLRGQFDCAAFVSVGQNPDLKKVLTDMIYDLDRQRYISIHNSRMDERLLINELRDFVQNKRYIIIIDDIWDEKLWEYIKCAFYRNKLCSRIITTTRKVTVSKACCSHDDAIYRMKPLSDDASKRLFYKRIFKHDNGCPPELEQVSIGILKKCAGMPLAIITIASLLANKQVQTRDQWHDVFNSIGRGLTEEPKVEDMTKILSFSYYDLPCHLKTCLLYLSIFPEDFIISRDHLVRMWIAEGVVQKTTNQKDDVLVELGENYFYELINRSMIQPWDENDFMYYKDGYDNAIISCRVHDMVLDLILSLSNEENFVTILDQERGASSLSKAHRISLRDCNVVHTIPEATVPKVRFLSLLRADVHMTPAITIFPILRVLDLYNCHFEESYHLKHLGNLFHLRYLRLHCGCITKLPNEIGNLQFLQTLDVHRSRSIKELPPAIYQLRRLMFLYFPENISLSDRIGELTSLLELSPVDVFRRTSSIDVNGDSFSLLKALGNLTELRDLTIQVWSSEVSSIGRILGEVLCNLHKLRRLILRGVHGIVHLDSLPEFLDLPQHIHVLGIKPMYFFTVLPVWFNFPIDLPYLSFLDLSICDMRQEHVEKLGRLPALQVLWIQINRESEWLVIGAGAFPSLTDCTFIQYCGLVFQPGAMPKVRKLEFNINVVDSEDINFDVGLGNLASIEEVTIDLLCEDAVEWEVEEVENVLRHVADIHPKHPTLEMRRSDEDKMVLDDE

superfamily: SSF52540
156-409 SSF52540

TATVDPRILALYKDITELVGIEEARDELIGMLSRPADDDQLNIVSVVGFGGLGKTTLAKVVYDKLRGQFDCAAFVSVGQNPDLKKVLTDMIYDLDRQRYISIHNSRMDERLLINELRDFVQNKRYIIIIDDIWDEKLWEYIKCAFYRNKLCSRIITTTRKVTVSKACCSHDDAIYRMKPLSDDASKRLFYKRIFKHDNGCPPELEQVSIGILKKCAGMPLAIITIASLLANKQVQTRDQWHDVFNSIGRGLTEE

Gene3D: G3DSA:3.40.50.300
170-294 G3DSA:3.40.50.300

ITELVGIEEARDELIGMLSRPADDDQLNIVSVVGFGGLGKTTLAKVVYDKLRGQFDCAAFVSVGQNPDLKKVLTDMIYDLDRQRYISIHNSRMDERLLINELRDFVQNKRYIIIIDDIWDEKLWE

HMMPfam: PF00931
IPR002182
178-463 NB-ARC,NBS
NB-ARC

EARDELIGMLSRPADDDQLNIVSVVGFGGLGKTTLAKVVYDKLRGQFDCAAFVSVGQNPDLKKVLTDMIYDLDRQRYISIHNSRMDERLLINELRDFVQNKRYIIIIDDIWDEKLWEYIKCAFYRNKLCSRIITTTRKVTVSKACCSHDDAIYRMKPLSDDASKRLFYKRIFKHDNGCPPELEQVSIGILKKCAGMPLAIITIASLLANKQVQTRDQWHDVFNSIGRGLTEEPKVEDMTKILSFSYYDLPCHLKTCLLYLSIFPEDFIISRDHLVRMWIAEGVVQK

FPrintScan: PR00364
IPR000767
198-213 DISEASERSIST
Disease resistance protein

IVSVVGFGGLGKTTLA

FPrintScan: PR00364
IPR000767
274-288 DISEASERSIST
Disease resistance protein

FVQNKRYIIIIDDIW

FPrintScan: PR00364
IPR000767
370-384 DISEASERSIST
Disease resistance protein

CAGMPLAIITIASLL

Gene3D: G3DSA:3.80.10.10
511-851 G3DSA:3.80.10.10

CRVHDMVLDLILSLSNEENFVTILDQERGASSLSKAHRISLRDCNVVHTIPEATVPKVRFLSLLRADVHMTPAITIFPILRVLDLYNCHFEESYHLKHLGNLFHLRYLRLHCGCITKLPNEIGNLQFLQTLDVHRSRSIKELPPAIYQLRRLMFLYFPENISLSDRIGELTSLLELSPVDVFRRTSSIDVNGDSFSLLKALGNLTELRDLTIQVWSSEVSSIGRILGEVLCNLHKLRRLILRGVHGIVHLDSLPEFLDLPQHIHVLGIKPMYFFTVLPVWFNFPIDLPYLSFLDLSICDMRQEHVEKLGRLPALQVLWIQINRESEWLVIGAGAFPSLTDC

superfamily: SSF52058
512-902 SSF52058,LRR

RVHDMVLDLILSLSNEENFVTILDQERGASSLSKAHRISLRDCNVVHTIPEATVPKVRFLSLLRADVHMTPAITIFPILRVLDLYNCHFEESYHLKHLGNLFHLRYLRLHCGCITKLPNEIGNLQFLQTLDVHRSRSIKELPPAIYQLRRLMFLYFPENISLSDRIGELTSLLELSPVDVFRRTSSIDVNGDSFSLLKALGNLTELRDLTIQVWSSEVSSIGRILGEVLCNLHKLRRLILRGVHGIVHLDSLPEFLDLPQHIHVLGIKPMYFFTVLPVWFNFPIDLPYLSFLDLSICDMRQEHVEKLGRLPALQVLWIQINRESEWLVIGAGAFPSLTDCTFIQYCGLVFQPGAMPKVRKLEFNINVVDSEDINFDVGLGNLASIEEVTID

FPrintScan: PR00364
IPR000767
633-649 DISEASERSIST
Disease resistance protein

GNLQFLQTLDVHRSRSI


List of References




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox