PRGDB00049888 (Os11g0639600)

From PRG Wiki
Jump to: navigation, search
Os11g0639600
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 115486402 (NM_001074877)
Gene Class NL
Domain Type LRR, NBS, LRR, LRR, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa (japonica cultivar-group) Os11g0639600 (Os11g0639600) mRNA, complete cds.

DNA Sequence

ATGGCAGAAACTGCAATATACCTAGCTCTCAGAAAAATAGGAATTGCCCTAGGACGAGAGAGAAGTGCTACTGCTTTGGAACATGACCTTGAAGGAAGATCAGCTTTGGAACATGGCCTTGAAGGAGGATCCTTTCTAATTAGATCTCTTACCAGAGTAATATCTGAGATTATTAATAGTAATGATATATTAGTTCTTAGGCAAGCAGAACTTCAAGGTAGATTGAGGCGAATAGAAAGTGAACTTCGCATGATCCTTTGCTTCCTGGCTCAAATAGAAACAAGATATGATAACAAGCAAGTACTTCAAAGTTGGATTGGGGAAGCACGGAAACTAGGATGCCTTGTTGAACAAATAATGGACGAATATATTGTCTATATTGTACAGAGCAAACAATATCGACTTACCAAGAGAGTACAGGTTATACTGGCCTCACATCGCTTCACTGCTCAGCTGAAAGAAATTGAGGTGGAGCTGGAGCATCTTTCCAAAATGAAAAAACGATGGGTTCAAGTGGACAAGGAAACCTCATTAGCTTCTTCATCATCAATGTTTGGTCCTCATGTCAACAACATAGATACTAAGCGATATGCCGAAAGAAAGGAAGAACTGATTGAATCGCTAAAGAGTAAAGATATGACGAAAGATGGAGCTCTTTCTGTGATTGCAGTGTATGGTCAGCCTGGGTCAGGGAAAACCCATCTTGTTAAGGATGTTTATGCTAGTGAGAAGAAGTATTTCAGTACTTCTGCGTGGATTTCCATTGCTCAATGTCCCAATGCTGACACTGATGCTTTGAAAAGAATGATGATGGAAGAACTAGGAAGGCAAGTTGGCACTTCCACTGAGAGTACCTCACTGAGAGTAATGACGGAAAATCAGGATAGCAAGTTCCTGTTTGTATTTGACGATGTATGGGTGCCAGACATGGTTCACAAGGTACACCGTGCAGCTTCTGATAATAAAATGGGCAGCCGGATAATCATAATCGCTCGGATGCCAGAGGTTGCTTTTGTAAGAAGTGAATCTTCAGTGGAGTCACAGTCCCAAACACCATCTAGTTCGCTGGAACCTGTAAGACCCTCGGCGAGAGTCCCCAAGGAATTCATGAAGCTTACTTGTTTACATCCTAATGACAGTTTTGATATCTTCTGTACAAAGGCTTTTGGAAGACCAAGTGACTGCCCTATAGAACTCCGTGAAGTAACTTTGAAGATTATTGGCTTGTGCAATTTTCTTCCCCAAGCAATTGTTTCTATTGGAGCATTGCTCAGCTCAAAGCAAAAAACAGAGTCAGTCTGGAGTGAAATGGCTCAACAAATTGAAGATATTCAAAAAAGCAAGTCAAGCCTGAACAATGTGCAAAAAGTACTATATCTCAGTTACAAGAACCTTCCAATGCATCTCAAGAACTGCCTTTTGTATTGTAGTACTTTTCCGGCTGGTTTTCTCCTGTTGCCTGAGAGTCTTGTCCGGTTATGGGCTGCAGAGGGTTTCATCGAGAACCAGGGATCATTGCAAGTGGAGGAAATTGGTGAGCGCTATATAAAGGAGCTAATCCACTGGGGATTTCTGCAGGTTGTAGATGTGGACGAACAAGGTAGAGTAGCAAGTTGCAGGATGCCTATTGTGGTGCATGAGCTGGCTGTATCTATCTCTCAAAAGGAAGAATTTGGAGCTATCTGCCATGGTGGTAAACTAGCAGAGATGGATACCAATGTCCGCTGCCTATTTATCTCGGAAAACCCTGAAGATATTGGTGCATTAGTAGATTTTCCGTACCTTCGGACTCTTATGGCCAGCAGAAATGCTGCTGCAAATTTGAAGTCCTTACCGGCATCACTGACAGCCAAACTTAAGTATCTTACTGTTCTGAAACTGCAAGAATCTCCACTTGAAGAATTGCCCAGAGGTATTGGCTACCAGCTGTTTAATTTGCGATATCTTGGCTTGCGAAAATCACAAATACGATGCCTTCCATCTTCCATGGCCAATCTCTACAACCTGCAAACTTTGGACCTCAGGGGGAGCAGAATAAATGAACTGCCAAGTTGGATAGGCAAACTCATAAGATTGAGGCATCTTTCTGCTGACACATTGGATGGCCAAGGCCCAGACATATACCGAGCTGTGAAAGCCCCGAAAACTGTGAACTACCTGAAAGAATTGCGGACTCTCGAGACAGTGCAGGCAAGTGATACCTTTGAGAAGCATGTGGAGAAGCTGACCCAGTTAACTACTCTATCTGTTGTTATTGGAGAAGGCCGATCCAGCAAAACATTGTTTTCTTCATTGTCGAAGCTTTCCTGTCTTTCTAGTTTGCATGTCAGTGCAAGTCGTGTGGACGAGGAGTCTCTTGACTTTGAAACCCTGAATCCTACTAGTCTTGAAAAACTTGTTATCAGGGGCGGGTTGGCTGAGCAGACATTCCAATATCCTATTTTCAAATCTAAACAGATTAAAGTTCTGGAGTTAAGCTTGTGCAAGCTAAGGGATGATTCGCTCGTCCTACTATCTACAAATTTGTGTAACCTTGAATCGCTCCGCCTCCATAATATCAGTGGCATCTCCAAGCTGGTATTTCAAGCAATTAACAGTTTTGCCAACTTGAGGACACTTTTACTACATGAAATTGATGGAGTGGATGAACTTGAGATTCCAAATGGTTCGTTGGGAAGTCTTCAAGTTCTCCATGTGGTAAAAATAAGTCAGCTGAACAGTATCCATGACCAGGAGAGAATCATATCCGTCAGGGACCTATACTTTCCACAGTTATGGCTATCCAGAGAGAAACGAAATGCCAGCTAG


Protein sequences

Name Description Sequence
hypothetical protein Os11g0639600 [Oryza sativa (japonica cultivar-group)].

MAETAIYLALRKIGIALGRERSATALEHDLEGRSALEHGLEGGSFLIRSLTRVISEIINSNDILVLRQAELQGRLRRIESELRMILCFLAQIETRYDNKQVLQSWIGEARKLGCLVEQIMDEYIVYIVQSKQYRLTKRVQVILASHRFTAQLKEIEVELEHLSKMKKRWVQVDKETSLASSSSMFGPHVNNIDTKRYAERKEELIESLKSKDMTKDGALSVIAVYGQPGSGKTHLVKDVYASEKKYFSTSAWISIAQCPNADTDALKRMMMEELGRQVGTSTESTSLRVMTENQDSKFLFVFDDVWVPDMVHKVHRAASDNKMGSRIIIIARMPEVAFVRSESSVESQSQTPSSSLEPVRPSARVPKEFMKLTCLHPNDSFDIFCTKAFGRPSDCPIELREVTLKIIGLCNFLPQAIVSIGALLSSKQKTESVWSEMAQQIEDIQKSKSSLNNVQKVLYLSYKNLPMHLKNCLLYCSTFPAGFLLLPESLVRLWAAEGFIENQGSLQVEEIGERYIKELIHWGFLQVVDVDEQGRVASCRMPIVVHELAVSISQKEEFGAICHGGKLAEMDTNVRCLFISENPEDIGALVDFPYLRTLMASRNAAANLKSLPASLTAKLKYLTVLKLQESPLEELPRGIGYQLFNLRYLGLRKSQIRCLPSSMANLYNLQTLDLRGSRINELPSWIGKLIRLRHLSADTLDGQGPDIYRAVKAPKTVNYLKELRTLETVQASDTFEKHVEKLTQLTTLSVVIGEGRSSKTLFSSLSKLSCLSSLHVSASRVDEESLDFETLNPTSLEKLVIRGGLAEQTFQYPIFKSKQIKVLELSLCKLRDDSLVLLSTNLCNLESLRLHNISGISKLVFQAINSFANLRTLLLHEIDGVDELEIPNGSLGSLQVLHVVKISQLNSIHDQERIISVRDLYFPQLWLSREKRNAS

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
43-921 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GSFLIRSLTRVISEIINSNDILVLRQAELQGRLRRIESELRMILCFLAQIETRYDNKQVLQSWIGEARKLGCLVEQIMDEYIVYIVQSKQYRLTKRVQVILASHRFTAQLKEIEVELEHLSKMKKRWVQVDKETSLASSSSMFGPHVNNIDTKRYAERKEELIESLKSKDMTKDGALSVIAVYGQPGSGKTHLVKDVYASEKKYFSTSAWISIAQCPNADTDALKRMMMEELGRQVGTSTESTSLRVMTENQDSKFLFVFDDVWVPDMVHKVHRAASDNKMGSRIIIIARMPEVAFVRSESSVESQSQTPSSSLEPVRPSARVPKEFMKLTCLHPNDSFDIFCTKAFGRPSDCPIELREVTLKIIGLCNFLPQAIVSIGALLSSKQKTESVWSEMAQQIEDIQKSKSSLNNVQKVLYLSYKNLPMHLKNCLLYCSTFPAGFLLLPESLVRLWAAEGFIENQGSLQVEEIGERYIKELIHWGFLQVVDVDEQGRVASCRMPIVVHELAVSISQKEEFGAICHGGKLAEMDTNVRCLFISENPEDIGALVDFPYLRTLMASRNAAANLKSLPASLTAKLKYLTVLKLQESPLEELPRGIGYQLFNLRYLGLRKSQIRCLPSSMANLYNLQTLDLRGSRINELPSWIGKLIRLRHLSADTLDGQGPDIYRAVKAPKTVNYLKELRTLETVQASDTFEKHVEKLTQLTTLSVVIGEGRSSKTLFSSLSKLSCLSSLHVSASRVDEESLDFETLNPTSLEKLVIRGGLAEQTFQYPIFKSKQIKVLELSLCKLRDDSLVLLSTNLCNLESLRLHNISGISKLVFQAINSFANLRTLLLHEIDGVDELEIPNGSLGSLQVLHVVKISQLNSIHDQERIISVRDLY

HMMPanther: PTHR23155:SF213
43-921 PTHR23155:SF213,OS11G0639600 PROTEIN

GSFLIRSLTRVISEIINSNDILVLRQAELQGRLRRIESELRMILCFLAQIETRYDNKQVLQSWIGEARKLGCLVEQIMDEYIVYIVQSKQYRLTKRVQVILASHRFTAQLKEIEVELEHLSKMKKRWVQVDKETSLASSSSMFGPHVNNIDTKRYAERKEELIESLKSKDMTKDGALSVIAVYGQPGSGKTHLVKDVYASEKKYFSTSAWISIAQCPNADTDALKRMMMEELGRQVGTSTESTSLRVMTENQDSKFLFVFDDVWVPDMVHKVHRAASDNKMGSRIIIIARMPEVAFVRSESSVESQSQTPSSSLEPVRPSARVPKEFMKLTCLHPNDSFDIFCTKAFGRPSDCPIELREVTLKIIGLCNFLPQAIVSIGALLSSKQKTESVWSEMAQQIEDIQKSKSSLNNVQKVLYLSYKNLPMHLKNCLLYCSTFPAGFLLLPESLVRLWAAEGFIENQGSLQVEEIGERYIKELIHWGFLQVVDVDEQGRVASCRMPIVVHELAVSISQKEEFGAICHGGKLAEMDTNVRCLFISENPEDIGALVDFPYLRTLMASRNAAANLKSLPASLTAKLKYLTVLKLQESPLEELPRGIGYQLFNLRYLGLRKSQIRCLPSSMANLYNLQTLDLRGSRINELPSWIGKLIRLRHLSADTLDGQGPDIYRAVKAPKTVNYLKELRTLETVQASDTFEKHVEKLTQLTTLSVVIGEGRSSKTLFSSLSKLSCLSSLHVSASRVDEESLDFETLNPTSLEKLVIRGGLAEQTFQYPIFKSKQIKVLELSLCKLRDDSLVLLSTNLCNLESLRLHNISGISKLVFQAINSFANLRTLLLHEIDGVDELEIPNGSLGSLQVLHVVKISQLNSIHDQERIISVRDLY

Gene3D: G3DSA:3.40.50.300
199-329 G3DSA:3.40.50.300

ERKEELIESLKSKDMTKDGALSVIAVYGQPGSGKTHLVKDVYASEKKYFSTSAWISIAQCPNADTDALKRMMMEELGRQVGTSTESTSLRVMTENQDSKFLFVFDDVWVPDMVHKVHRAASDNKMGSRIII

superfamily: SSF52540
201-431 SSF52540

KEELIESLKSKDMTKDGALSVIAVYGQPGSGKTHLVKDVYASEKKYFSTSAWISIAQCPNADTDALKRMMMEELGRQVGTSTESTSLRVMTENQDSKFLFVFDDVWVPDMVHKVHRAASDNKMGSRIIIIARMPEVAFVRSESSVESQSQTPSSSLEPVRPSARVPKEFMKLTCLHPNDSFDIFCTKAFGRPSDCPIELREVTLKIIGLCNFLPQAIVSIGALLSSKQKTE

HMMPfam: PF00931
IPR002182
202-341 NB-ARC,NBS
NB-ARC

EELIESLKSKDMTKDGALSVIAVYGQPGSGKTHLVKDVYASEKKYFSTSAWISIAQCPNADTDALKRMMMEELGRQVGTSTESTSLRVMTENQDSKFLFVFDDVWVPDMVHKVHRAASDNKMGSRIIIIARMPEVAFVRS

FPrintScan: PR00364
IPR000767
221-236 DISEASERSIST
Disease resistance protein

VIAVYGQPGSGKTHLV

FPrintScan: PR00364
IPR000767
292-306 DISEASERSIST
Disease resistance protein

ENQDSKFLFVFDDVW

HMMPfam: PF00931
IPR002182
362-502 NB-ARC,NBS
NB-ARC

SARVPKEFMKLTCLHPNDSFDIFCTKAFGRPSDCPIELREVTLKIIGLCNFLPQAIVSIGALLSSKQKTESVWSEMAQQIEDIQKSKSSLNNVQKVLYLSYKNLPMHLKNCLLYCSTFPAGFLLLPESLVRLWAAEGFIEN

FPrintScan: PR00364
IPR000767
410-424 DISEASERSIST
Disease resistance protein

CNFLPQAIVSIGALL

superfamily: SSF52058
540-928 SSF52058,LRR

RMPIVVHELAVSISQKEEFGAICHGGKLAEMDTNVRCLFISENPEDIGALVDFPYLRTLMASRNAAANLKSLPASLTAKLKYLTVLKLQESPLEELPRGIGYQLFNLRYLGLRKSQIRCLPSSMANLYNLQTLDLRGSRINELPSWIGKLIRLRHLSADTLDGQGPDIYRAVKAPKTVNYLKELRTLETVQASDTFEKHVEKLTQLTTLSVVIGEGRSSKTLFSSLSKLSCLSSLHVSASRVDEESLDFETLNPTSLEKLVIRGGLAEQTFQYPIFKSKQIKVLELSLCKLRDDSLVLLSTNLCNLESLRLHNISGISKLVFQAINSFANLRTLLLHEIDGVDELEIPNGSLGSLQVLHVVKISQLNSIHDQERIISVRDLYFPQLWLS

Gene3D: G3DSA:3.80.10.10
579-774 G3DSA:3.80.10.10

ISENPEDIGALVDFPYLRTLMASRNAAANLKSLPASLTAKLKYLTVLKLQESPLEELPRGIGYQLFNLRYLGLRKSQIRCLPSSMANLYNLQTLDLRGSRINELPSWIGKLIRLRHLSADTLDGQGPDIYRAVKAPKTVNYLKELRTLETVQASDTFEKHVEKLTQLTTLSVVIGEGRSSKTLFSSLSKLSCLSSL

FPrintScan: PR00364
IPR000767
664-680 DISEASERSIST
Disease resistance protein

ANLYNLQTLDLRGSRIN

Gene3D: G3DSA:3.80.10.10
775-906 G3DSA:3.80.10.10

HVSASRVDEESLDFETLNPTSLEKLVIRGGLAEQTFQYPIFKSKQIKVLELSLCKLRDDSLVLLSTNLCNLESLRLHNISGISKLVFQAINSFANLRTLLLHEIDGVDELEIPNGSLGSLQVLHVVKISQLN


List of References




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox