PRGDB00049892 (Os11g0606500)

From PRG Wiki
Jump to: navigation, search
Os11g0606500
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 115486214 (NM_001074783)
Gene Class NL
Domain Type LRR, NBS, LRR, LRR, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa (japonica cultivar-group) Os11g0606500 (Os11g0606500) mRNA, complete cds.

DNA Sequence

ATGGATCTGGTCGTCGGCGCGTCGAGCGGCGCCGTGAAGTCGCTCGTCAACAAGCTGGGCACCCTCCTGGCGCAGGAGTACACCCTCATCTCCGGCGTCCGCGACGACATCCAGTACATCAACGACGAGCTCGCCAGCATGCAGGCCTTCCTCAGCAGGCTCAAGCGGGACGTCGCCCACGACGAGCAGCGTCAGGACTGGATGAAGCAGGTGCGCGAGGTCGCCTACGACATCGAGGACTGCGTCGACGACGTCCGCCACCGCCTCGGCGGCGAGCCCCGCGGGACCGGCACAGTTGTCTCCCTCAAGAGGACGTGGTACCTGCTCACCACGCTGTACCAGCGCTGCTGCATCGCCACCGACATCGGCAACCTCAAGGTCAGGGCGCAGCATGTCAGCGAGCGGCGCACCAGGTACGGGGTGGAGAACCTCCCAGCAAACAGAAATGGTGGCGGCAACAACAACTCCGGCGCTCCCGGAGACCATCCAGCTCCTCTCCCCCGGCTGATTGGCACCACTGAACCTGTAGGCATGGACGACGCCATGAACGACCTTCAAAGATGGTTCATGGTCTCAAAGCAGAACAGCCAAATCAGTTACCTTGCTATCGTCGGATCCGGTGGGCTTGGCAAAACCACACTCGCAATGTCATTTTACCGCAAGTTTGGAGATGAGTTTGATTCCAGAGCGTTCATGCTCGCGTCGCAGAAGTTTCATCTCCCAACAGTTTTGAGAAGCCTTGTCAGCCAGTTCCATCAGAAGCAGGTCAGCGCTTCTGAGGATGCTCTTCACGGAATTGAGGAATGGGGAGTTGAAGCCCTCAAGAAGAAGCTCGCTGATCAACTGCAAGGCAAGAGGTACCATATCTTGATTGATGACATATGGTCTGTATCAGCATGGGAAAGTATTAGGGATTCATTACCTAAGAATAATAAGGGTAGTTGCGTAATTGTGACTACCAGGTTTAACTCTGTAGCTGAAGCCTGCCGCCGTCAAAATGGTCATGTGCACAAGCTCAAACAGCTCGATCCAGTGAACTCCAGCAAATTGTTTCTTCAAATAATATATGCTAATGATCCGTGTCCCACTCCAACCATTAATGATGAGATTGTCGTGAAGATGTGTGGTGGTCTGCCTTTGGCCATAATAGTAGTGTCAGGGCTCATTGCTAGTGAACTGAAATCAAAGATTGGAAAGCCATTGGATCAGAAATTGATTGAGGTGGAGAAGGCTTTAAGGGCAGAGTTGGGAAACAATCTCACCACAGAAGTAGTGCAGATAATTAACCACTGCTACAAAAATCTGCCACCTGACCTTAAGACATGTTTGCTCTACTTGAGTACATTTCCAAAGGGCCGCAATATTAGCAGGAAACGATTGATAAGAAGATGGGTTGCTGAAGGGTTCGTTACTGAGAAACATGGGCAGACGGCAGAGGAAGTTGCAGAAGACAACTTCAATGAGCTCATTGGCAGGAACTTGATTCGGCCTATCAACAACAGCAGCAATGGGAAGGTGAAGAGCTGTCAAATTCATGACATGGTCCTTGAGTACATTGTCTCCAAATCTGGTGATGAGAATTTCATCACTGTAATTGGTAGCCACTGGCAGACACCGTTTCCAAGCTACAAGGTGCGGCGGTTGTCTGTCCATAAAAGTGATAGGCAAGAAACTGATCTAGTAGAGAGGATGAAGTTGTCGCATGTCCGATCTTTGACTGTGTTGGAGAGTTTCAAAGCTCTTCATTCTACTATGCTCAAATTCCAGATACTGCAGGTGTTGGATCTTGAAGGATGCAAGGACTTGTCGTCAAACCAGCTCAAGAAAATATGTAATATGCATCAGATGAAGTACCTAAGCTTGCGTGGGACGGACATATACAAGATACCGAAGAAAATAGGCAGGCTGGAGTATTTGGAGGTACTTGACATAAGGGACACGGATGTCACAAACTTGCCTGCATCAGTGGAGAGGCTTCAACGAATGGTCCATCTATTGGCTGGCAATAAAACCAAGCGGAGAGCATTGAGATTAACTGAAGGAATCACAAAGATGAAAACTATACAGACACTGTCTGGGATTGAGATCTCTGGAAGGTCAACCAGGACAGCAGCTGGGGAGCAGGCACCAGTTCTTGAAGTCATCAGAAATGCTACAACCACCGATGCCAAGGATGGAGATATCGCGGGCTTGCAAGGTACCCGTAAGGAAGGCAGCAAGGTGGATATGCCAAAACAATTGCGTCCGCTAGCAGCCTTGGAGAAGCTCACCAACCTTAAGAAACTTGCCATTTACAGGCTTGTTAATTTCCAAGCGAAAGATGATGAATTGTTGCTCTCTGCTATTGAGCATTTGAGCAGTTGTTCTCTCAAGTTTCTTGCAATTGATGACAGTTTCACAGGCTTTCTTGACAGATCACTGAGTTCTTCACAAGCACAACCAGAACACCTTTACACCCTTGAGCTTTCTGGCAGCTTGTTTAAAGTGCCAGAATGGATTGACCGCTTGCACAACCTTGAGAAGCTTACTCTGTCCATGACTTCACTTACGACAGATACTTTGGTGACTCTTAGTAGGCTTCCTGAGCTTTTCTCTCTCATTTTTTCACTTGATGCAGCAAATGGTATTTCAAATATCCTCAAAACTGTGCAGAAGAATACATTGGAGTCAGGTGGTAAAATCTTTGTGCCGGATGGGGGGTTTACAAAGTTGAGGTTGCTCCGTTTTACGGCACCAGTGCTACCACCTCTGAGCTTCCTAGAAGGGGCAATGCCAGAGCTTCAGAGGCTTGAGCTGAGGTTCAGAATCATTGAGTTTGTATACGGCCTGGAAAACCTTTCAAGTCTCCAACAGGTATTTCTGACCTTTAGCAGCCAGGCACCTGAAGATGCGAAAGAGAAGGTCTCTCAGATCAAAGGACTGGCAAGCAAGATTCGAAAGGCTGATTCCTCCAACATTAGTGTGGTGATAGATGAGTACAACGAATTATCAAAAGAACAATAG


Protein sequences

Name Description Sequence
hypothetical protein Os11g0606500 [Oryza sativa (japonica cultivar-group)].

MDLVVGASSGAVKSLVNKLGTLLAQEYTLISGVRDDIQYINDELASMQAFLSRLKRDVAHDEQRQDWMKQVREVAYDIEDCVDDVRHRLGGEPRGTGTVVSLKRTWYLLTTLYQRCCIATDIGNLKVRAQHVSERRTRYGVENLPANRNGGGNNNSGAPGDHPAPLPRLIGTTEPVGMDDAMNDLQRWFMVSKQNSQISYLAIVGSGGLGKTTLAMSFYRKFGDEFDSRAFMLASQKFHLPTVLRSLVSQFHQKQVSASEDALHGIEEWGVEALKKKLADQLQGKRYHILIDDIWSVSAWESIRDSLPKNNKGSCVIVTTRFNSVAEACRRQNGHVHKLKQLDPVNSSKLFLQIIYANDPCPTPTINDEIVVKMCGGLPLAIIVVSGLIASELKSKIGKPLDQKLIEVEKALRAELGNNLTTEVVQIINHCYKNLPPDLKTCLLYLSTFPKGRNISRKRLIRRWVAEGFVTEKHGQTAEEVAEDNFNELIGRNLIRPINNSSNGKVKSCQIHDMVLEYIVSKSGDENFITVIGSHWQTPFPSYKVRRLSVHKSDRQETDLVERMKLSHVRSLTVLESFKALHSTMLKFQILQVLDLEGCKDLSSNQLKKICNMHQMKYLSLRGTDIYKIPKKIGRLEYLEVLDIRDTDVTNLPASVERLQRMVHLLAGNKTKRRALRLTEGITKMKTIQTLSGIEISGRSTRTAAGEQAPVLEVIRNATTTDAKDGDIAGLQGTRKEGSKVDMPKQLRPLAALEKLTNLKKLAIYRLVNFQAKDDELLLSAIEHLSSCSLKFLAIDDSFTGFLDRSLSSSQAQPEHLYTLELSGSLFKVPEWIDRLHNLEKLTLSMTSLTTDTLVTLSRLPELFSLIFSLDAANGISNILKTVQKNTLESGGKIFVPDGGFTKLRLLRFTAPVLPPLSFLEGAMPELQRLELRFRIIEFVYGLENLSSLQQVFLTFSSQAPEDAKEKVSQIKGLASKIRKADSSNISVVIDEYNELSKEQ

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
8-1000 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

SSGAVKSLVNKLGTLLAQEYTLISGVRDDIQYINDELASMQAFLSRLKRDVAHDEQRQDWMKQVREVAYDIEDCVDDVRHRLGGEPRGTGTVVSLKRTWYLLTTLYQRCCIATDIGNLKVRAQHVSERRTRYGVENLPANRNGGGNNNSGAPGDHPAPLPRLIGTTEPVGMDDAMNDLQRWFMVSKQNSQISYLAIVGSGGLGKTTLAMSFYRKFGDEFDSRAFMLASQKFHLPTVLRSLVSQFHQKQVSASEDALHGIEEWGVEALKKKLADQLQGKRYHILIDDIWSVSAWESIRDSLPKNNKGSCVIVTTRFNSVAEACRRQNGHVHKLKQLDPVNSSKLFLQIIYANDPCPTPTINDEIVVKMCGGLPLAIIVVSGLIASELKSKIGKPLDQKLIEVEKALRAELGNNLTTEVVQIINHCYKNLPPDLKTCLLYLSTFPKGRNISRKRLIRRWVAEGFVTEKHGQTAEEVAEDNFNELIGRNLIRPINNSSNGKVKSCQIHDMVLEYIVSKSGDENFITVIGSHWQTPFPSYKVRRLSVHKSDRQETDLVERMKLSHVRSLTVLESFKALHSTMLKFQILQVLDLEGCKDLSSNQLKKICNMHQMKYLSLRGTDIYKIPKKIGRLEYLEVLDIRDTDVTNLPASVERLQRMVHLLAGNKTKRRALRLTEGITKMKTIQTLSGIEISGRSTRTAAGEQAPVLEVIRNATTTDAKDGDIAGLQGTRKEGSKVDMPKQLRPLAALEKLTNLKKLAIYRLVNFQAKDDELLLSAIEHLSSCSLKFLAIDDSFTGFLDRSLSSSQAQPEHLYTLELSGSLFKVPEWIDRLHNLEKLTLSMTSLTTDTLVTLSRLPELFSLIFSLDAANGISNILKTVQKNTLESGGKIFVPDGGFTKLRLLRFTAPVLPPLSFLEGAMPELQRLELRFRIIEFVYGLENLSSLQQVFLTFSSQAPEDAKEKVSQIKGLASKIRKADSSNISVVIDEYNELSKEQ

HMMPanther: PTHR23155:SF211
8-1000 PTHR23155:SF211,OS11G0606500 PROTEIN

SSGAVKSLVNKLGTLLAQEYTLISGVRDDIQYINDELASMQAFLSRLKRDVAHDEQRQDWMKQVREVAYDIEDCVDDVRHRLGGEPRGTGTVVSLKRTWYLLTTLYQRCCIATDIGNLKVRAQHVSERRTRYGVENLPANRNGGGNNNSGAPGDHPAPLPRLIGTTEPVGMDDAMNDLQRWFMVSKQNSQISYLAIVGSGGLGKTTLAMSFYRKFGDEFDSRAFMLASQKFHLPTVLRSLVSQFHQKQVSASEDALHGIEEWGVEALKKKLADQLQGKRYHILIDDIWSVSAWESIRDSLPKNNKGSCVIVTTRFNSVAEACRRQNGHVHKLKQLDPVNSSKLFLQIIYANDPCPTPTINDEIVVKMCGGLPLAIIVVSGLIASELKSKIGKPLDQKLIEVEKALRAELGNNLTTEVVQIINHCYKNLPPDLKTCLLYLSTFPKGRNISRKRLIRRWVAEGFVTEKHGQTAEEVAEDNFNELIGRNLIRPINNSSNGKVKSCQIHDMVLEYIVSKSGDENFITVIGSHWQTPFPSYKVRRLSVHKSDRQETDLVERMKLSHVRSLTVLESFKALHSTMLKFQILQVLDLEGCKDLSSNQLKKICNMHQMKYLSLRGTDIYKIPKKIGRLEYLEVLDIRDTDVTNLPASVERLQRMVHLLAGNKTKRRALRLTEGITKMKTIQTLSGIEISGRSTRTAAGEQAPVLEVIRNATTTDAKDGDIAGLQGTRKEGSKVDMPKQLRPLAALEKLTNLKKLAIYRLVNFQAKDDELLLSAIEHLSSCSLKFLAIDDSFTGFLDRSLSSSQAQPEHLYTLELSGSLFKVPEWIDRLHNLEKLTLSMTSLTTDTLVTLSRLPELFSLIFSLDAANGISNILKTVQKNTLESGGKIFVPDGGFTKLRLLRFTAPVLPPLSFLEGAMPELQRLELRFRIIEFVYGLENLSSLQQVFLTFSSQAPEDAKEKVSQIKGLASKIRKADSSNISVVIDEYNELSKEQ

superfamily: SSF52540
158-412 SSF52540

APGDHPAPLPRLIGTTEPVGMDDAMNDLQRWFMVSKQNSQISYLAIVGSGGLGKTTLAMSFYRKFGDEFDSRAFMLASQKFHLPTVLRSLVSQFHQKQVSASEDALHGIEEWGVEALKKKLADQLQGKRYHILIDDIWSVSAWESIRDSLPKNNKGSCVIVTTRFNSVAEACRRQNGHVHKLKQLDPVNSSKLFLQIIYANDPCPTPTINDEIVVKMCGGLPLAIIVVSGLIASELKSKIGKPLDQKLIEVEKAL

Gene3D: G3DSA:3.40.50.300
177-323 G3DSA:3.40.50.300

GMDDAMNDLQRWFMVSKQNSQISYLAIVGSGGLGKTTLAMSFYRKFGDEFDSRAFMLASQKFHLPTVLRSLVSQFHQKQVSASEDALHGIEEWGVEALKKKLADQLQGKRYHILIDDIWSVSAWESIRDSLPKNNKGSCVIVTTRFN

HMMPfam: PF00931
IPR002182
181-474 NB-ARC,NBS
NB-ARC

AMNDLQRWFMVSKQNSQISYLAIVGSGGLGKTTLAMSFYRKFGDEFDSRAFMLASQKFHLPTVLRSLVSQFHQKQVSASEDALHGIEEWGVEALKKKLADQLQGKRYHILIDDIWSVSAWESIRDSLPKNNKGSCVIVTTRFNSVAEACRRQNGHVHKLKQLDPVNSSKLFLQIIYANDPCPTPTINDEIVVKMCGGLPLAIIVVSGLIASELKSKIGKPLDQKLIEVEKALRAELGNNLTTEVVQIINHCYKNLPPDLKTCLLYLSTFPKGRNISRKRLIRRWVAEGFVTEKH

FPrintScan: PR00364
IPR000767
200-215 DISEASERSIST
Disease resistance protein

YLAIVGSGGLGKTTLA

FPrintScan: PR00364
IPR000767
281-295 DISEASERSIST
Disease resistance protein

QLQGKRYHILIDDIW

FPrintScan: PR00364
IPR000767
375-389 DISEASERSIST
Disease resistance protein

CGGLPLAIIVVSGLI

superfamily: SSF52047
543-877 SSF52047,LRR

YKVRRLSVHKSDRQETDLVERMKLSHVRSLTVLESFKALHSTMLKFQILQVLDLEGCKDLSSNQLKKICNMHQMKYLSLRGTDIYKIPKKIGRLEYLEVLDIRDTDVTNLPASVERLQRMVHLLAGNKTKRRALRLTEGITKMKTIQTLSGIEISGRSTRTAAGEQAPVLEVIRNATTTDAKDGDIAGLQGTRKEGSKVDMPKQLRPLAALEKLTNLKKLAIYRLVNFQAKDDELLLSAIEHLSSCSLKFLAIDDSFTGFLDRSLSSSQAQPEHLYTLELSGSLFKVPEWIDRLHNLEKLTLSMTSLTTDTLVTLSRLPELFSLIFSLDAANGIS

Gene3D: G3DSA:3.80.10.10
558-670 G3DSA:3.80.10.10

TDLVERMKLSHVRSLTVLESFKALHSTMLKFQILQVLDLEGCKDLSSNQLKKICNMHQMKYLSLRGTDIYKIPKKIGRLEYLEVLDIRDTDVTNLPASVERLQRMVHLLAGNK

FPrintScan: PR00364
IPR000767
586-602 DISEASERSIST
Disease resistance protein

LKFQILQVLDLEGCKDL

Gene3D: G3DSA:3.80.10.10
752-878 G3DSA:3.80.10.10

ALEKLTNLKKLAIYRLVNFQAKDDELLLSAIEHLSSCSLKFLAIDDSFTGFLDRSLSSSQAQPEHLYTLELSGSLFKVPEWIDRLHNLEKLTLSMTSLTTDTLVTLSRLPELFSLIFSLDAANGISN

Gene3D: G3DSA:3.80.10.10
915-933 G3DSA:3.80.10.10

PPLSFLEGAMPELQRLELR


List of References




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox