PRGDB00049901 (Os11g0551300)

From PRG Wiki
Jump to: navigation, search
Os11g0551300
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 115485868 (NM_001074610)
Gene Class CNL
Domain Type LRR, NBS, LRR, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa (japonica cultivar-group) Os11g0551300 (Os11g0551300) mRNA, complete cds.

DNA Sequence

ATGTCATCAACATCATGGCAATGTGGTGCTCATGTCTCCACATGCCGCATCTCAATTACCTTCCCAAAGGGATTTTCAGGATGTTACAAGTACCAGCTGCAGAAGAGCGTCAGGGGCGAGATCATGTTCCTCAAAGCTGAGTTGGAGAGCATGGAGGCAGCGCTGCTTGATGTCTCTGAGGCACCAATTGATCAGCCGCCTAATAATCAAGTCAAGCTTTGGGCGAGGAACGTCAGGGAGCTGTCCTACAACATCGAGGACAGCATTGACAAGTTCATGGTGCGCATTGACACCCATGCCGCACCTCACAAGCTGCATAGCTTCAGGGACTTCATTGATAGAAGCCTAGACCTGCTGACAAAGGCCAAGATCCGCCATTCCATCGGCACCGATATCAAAGACATCAAAAGCCGTATTAAGGAGATTAGTGAGCGTCGTGATAGATACAAGGTTGACAATGTTGTTACCGTACCATTTAGTCCAACTGTTGATAGCCTTCGCCTATCAGCTTTGTACAAGAAGATGACAGAACTCGTTGGCATCGAAGAGAAGAGCGACGAGCTAGTCAAGATGCTAATGGAGGGGGACAAGCAAGAACTGAAGATAGTCTCTATTGTAGGATTTGGTGGATTAGGCAAGACAACACTAGCTAAAGTAGTGTATGAAAAGCTTAAAGTACAATTCGCTTGTGGGTTCTTTGTTACCATGTCACTTAACCCCAACATGGAGAAGATTTTCAGCAACATGCTCTGTCAACTAGACAAGGAAAAATACAGTCACGTGACCAAAGCATCATGGGGTGAAGCACAACTTATCAAACGAAATACGGGAATTCCTTCAAAACAAGAGATTCTTGATGTTGCCAAAGAAGTTGGAGGTGTTTACCAACTAAAACCTCTTTCTCCTGCTGTTTCAAGAAAGTTGTTTTACCAAAAAATATTTGGTGCTGAAGGCAGATGTCCTGTTCAATTAGCTGTAGTGTCTGAAGGCATTTTAAAGAAATGTGGTGGTGTACCATTAGCTATCATTACAATAGCTAGTCTACTGGCCAGTAAAAACGATAGGGATAATATATTAGAGTACTGGTCCAAGGTGTACCATTCTATTGGTTCTGGGCTAGAAGATAATCTTCATGTGAATAATATGAGAAAGATATTGTCTGTCAGTTACTATAATTTACCACCACATTTGAGGGCTTGTTTATTGTACCTAAGCTGTTATCCGGAGGATACTAACATTGGCAACAAAGATGTGATATGGAAATGGATATGTGAAGGTTTTGTGCGTGCTGAACACATGAAGACTTTGCATGTTGTTGGAATGGAGTATTTAAATGAGCTCTGGAACAAAAGCTTGATACAGCCAATATCTAATTGTGATAACATGCCATGGGATTATTGTCTACATGATATGGTGCTTGACCTCATCACCTTCTTGTCGAACGAAGAGCAATTTATGACATCATTAGGTGATCAGCAGCCAATGCTAGTACCTCACAAGATCCGCCGACTATCCCTCCAATCTATCAAACAAGAGTACTTCAAGCTAATTTCAAATGCGGACCTATCCCATGTGAGATCACTGATTGTGTCCAAGCAAGCATTCAGTCTGTTACCAAACCTTTCGAGCTTTCCGGTGTTACGTGTGTTGGATTTAAGTGGTTGTGATCAAGTGGATAATCGTCATTGTAGGGATATTTGCAATACGCTTCACTTGAGGTATTTGAATCTACATAGGACATCTATATCTGAGATTCCAGAAGAGATTGGTAATTTACAGTTCTTGCTGGTATTGGACATAACTAAAACTAGACTAAGGGAAGTGCCATCAACCTTTGTGCAATTACAACAATTGGTGGACCTGTGTGTTGGCCCTGGGATGAGATTACCGGATGATTTTGGGAACTTGAAAACTCTACAAAGTATATGGCCACATATCTATGTCATGTCTCCAACCATGCTGCGCAATATGGGTGGTCTGACCAAGCTGAGGCATTTGTCAATACGATTTCATGAATGGGACGAGAGCTACCAGAAATCTTTTGAGTTGTGCCTATCCAACCTGGTCAATCTCAGATCAATAACCGTACGTGTATATGAGGGAGTCATGGATTCCAAATGTGAGAATTTATCACCGGGACCACAACAGCTTGAAGACATCGACATGAACAGGAGTGTGGCCAATTCAGTACCAATCTGGATGTCCTCATTGTCCTTCCTCTCATCCCTAGACATCAAGTTGAAAACATTGGGGCATAAGGACCTCCAAATCCTTGGGAACATGCCATCTCTTAGTGATCTTACCTTATGGGTGAATGAGCCCACGCAAGACAGACATGAAAGGTTGGTCATCGACAATTGTTATCCATTCCACTGTCTAACATTTCTTAAACTGATGGCTAACAACATGGAGGTGGCGTTTGCACAAGGACCCATGCAAAAGCTCCAAAAACTACGCTTTGGATTTGGAGTGCGGAAAACAGTGGATCAGTTTGGTAATTTCGACTTTGGACTGGAGAAGATCTCAGTTGAGCATTTAGATGTTTGCGTCAATTATTCCGACGCCAACAGATGGGAGGTGAACGCTGCGGAAGCTGCAATCCGGGAAGCGGTCAACATGAATCCCAACAACCCCACACTCAAGTTAACAACGGATAAATTAAACACTAAAGGAAACATGGTAAAGAAGAAGAACTGGGACAACAACCCTCACTGCGATATCTGCCCTGCAATAGGAACTGCAGAGTGCAGACCACATCATCCTAAGATGCAAGGCAGCTACAACTTATGGAAGAAATTAGGCCTTTTGCATCTATCTAATTTGGCAGAATCAGCCCCAAATTTCCTGGAGAAAGTTACTGTCAGCTATCACAACAATCAAGGCATAAAGCCCATTTGGTTTGCAGCCTGTGCACACACACTTTGGAAATCAAGAAACAACAGGATTTTTGAAGGACAGCAAACAGGTCTTTCAAATGTAATTCAAAAAATCATCAGCACTCTAGACTTATGGAATAACCGGGCCAATCCAGATGCCAAAGCAAAAATCAACCTCTGGTCTGAGACAATCAGAGCTACTACTACAACTACAATCGAGCCCAAATCCAACACCACTAAAGGACTAAATGATGCAGCCCTTACTCATCATGAGGGAGCACGCCCCAAGGATGACCACGAGCTGGCCGGTGGAGAACCCCAGCATCTTGCCTCCCCACGCGAATCACCGGCCGCCGCCGAGAAGGGGAAGAGGAATCCCGCCTTTCAACCGGCTCCTGGTAGAAGATGGAAGCCCTCGAAGCCCGCACGTTTCTTGGAGAAAGCGCGCCGAGCGGGGATAACCCCCGCCCCGGCGCCGCCGGCGAGCGGGCGGCGGGGGCGGGTCGAGGTTTGGCCTACGGGGCAGGCCCGCGCGCCGCCCGTGCAAGGGATCAAGCCTCGCCGGAGTTGGCTGAGGCTTAGGGTGGACGCGACCGAATCGCGGCGGCGCGGGGGGTTGCCGGCGGCGAGGGAGGAAGAAGAGGAGAAGTTTGGGCCGTTAGATGGGCTGGATGATGGACTTTGCTTTTATCTGGCCCAATGA


Protein sequences

Name Description Sequence
hypothetical protein Os11g0551300 [Oryza sativa (japonica cultivar-group)].

MSSTSWQCGAHVSTCRISITFPKGFSGCYKYQLQKSVRGEIMFLKAELESMEAALLDVSEAPIDQPPNNQVKLWARNVRELSYNIEDSIDKFMVRIDTHAAPHKLHSFRDFIDRSLDLLTKAKIRHSIGTDIKDIKSRIKEISERRDRYKVDNVVTVPFSPTVDSLRLSALYKKMTELVGIEEKSDELVKMLMEGDKQELKIVSIVGFGGLGKTTLAKVVYEKLKVQFACGFFVTMSLNPNMEKIFSNMLCQLDKEKYSHVTKASWGEAQLIKRNTGIPSKQEILDVAKEVGGVYQLKPLSPAVSRKLFYQKIFGAEGRCPVQLAVVSEGILKKCGGVPLAIITIASLLASKNDRDNILEYWSKVYHSIGSGLEDNLHVNNMRKILSVSYYNLPPHLRACLLYLSCYPEDTNIGNKDVIWKWICEGFVRAEHMKTLHVVGMEYLNELWNKSLIQPISNCDNMPWDYCLHDMVLDLITFLSNEEQFMTSLGDQQPMLVPHKIRRLSLQSIKQEYFKLISNADLSHVRSLIVSKQAFSLLPNLSSFPVLRVLDLSGCDQVDNRHCRDICNTLHLRYLNLHRTSISEIPEEIGNLQFLLVLDITKTRLREVPSTFVQLQQLVDLCVGPGMRLPDDFGNLKTLQSIWPHIYVMSPTMLRNMGGLTKLRHLSIRFHEWDESYQKSFELCLSNLVNLRSITVRVYEGVMDSKCENLSPGPQQLEDIDMNRSVANSVPIWMSSLSFLSSLDIKLKTLGHKDLQILGNMPSLSDLTLWVNEPTQDRHERLVIDNCYPFHCLTFLKLMANNMEVAFAQGPMQKLQKLRFGFGVRKTVDQFGNFDFGLEKISVEHLDVCVNYSDANRWEVNAAEAAIREAVNMNPNNPTLKLTTDKLNTKGNMVKKKNWDNNPHCDICPAIGTAECRPHHPKMQGSYNLWKKLGLLHLSNLAESAPNFLEKVTVSYHNNQGIKPIWFAACAHTLWKSRNNRIFEGQQTGLSNVIQKIISTLDLWNNRANPDAKAKINLWSETIRATTTTTIEPKSNTTKGLNDAALTHHEGARPKDDHELAGGEPQHLASPRESPAAAEKGKRNPAFQPAPGRRWKPSKPARFLEKARRAGITPAPAPPASGRRGRVEVWPTGQARAPPVQGIKPRRSWLRLRVDATESRRRGGLPAAREEEEEKFGPLDGLDDGLCFYLAQ

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
31-848 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

YQLQKSVRGEIMFLKAELESMEAALLDVSEAPIDQPPNNQVKLWARNVRELSYNIEDSIDKFMVRIDTHAAPHKLHSFRDFIDRSLDLLTKAKIRHSIGTDIKDIKSRIKEISERRDRYKVDNVVTVPFSPTVDSLRLSALYKKMTELVGIEEKSDELVKMLMEGDKQELKIVSIVGFGGLGKTTLAKVVYEKLKVQFACGFFVTMSLNPNMEKIFSNMLCQLDKEKYSHVTKASWGEAQLIKRNTGIPSKQEILDVAKEVGGVYQLKPLSPAVSRKLFYQKIFGAEGRCPVQLAVVSEGILKKCGGVPLAIITIASLLASKNDRDNILEYWSKVYHSIGSGLEDNLHVNNMRKILSVSYYNLPPHLRACLLYLSCYPEDTNIGNKDVIWKWICEGFVRAEHMKTLHVVGMEYLNELWNKSLIQPISNCDNMPWDYCLHDMVLDLITFLSNEEQFMTSLGDQQPMLVPHKIRRLSLQSIKQEYFKLISNADLSHVRSLIVSKQAFSLLPNLSSFPVLRVLDLSGCDQVDNRHCRDICNTLHLRYLNLHRTSISEIPEEIGNLQFLLVLDITKTRLREVPSTFVQLQQLVDLCVGPGMRLPDDFGNLKTLQSIWPHIYVMSPTMLRNMGGLTKLRHLSIRFHEWDESYQKSFELCLSNLVNLRSITVRVYEGVMDSKCENLSPGPQQLEDIDMNRSVANSVPIWMSSLSFLSSLDIKLKTLGHKDLQILGNMPSLSDLTLWVNEPTQDRHERLVIDNCYPFHCLTFLKLMANNMEVAFAQGPMQKLQKLRFGFGVRKTVDQFGNFDFGLEKISVEHLDV

HMMPanther: PTHR23155:SF205
31-848 OS11G0550500 PROTEIN,OS11G0550500 PROTEIN

YQLQKSVRGEIMFLKAELESMEAALLDVSEAPIDQPPNNQVKLWARNVRELSYNIEDSIDKFMVRIDTHAAPHKLHSFRDFIDRSLDLLTKAKIRHSIGTDIKDIKSRIKEISERRDRYKVDNVVTVPFSPTVDSLRLSALYKKMTELVGIEEKSDELVKMLMEGDKQELKIVSIVGFGGLGKTTLAKVVYEKLKVQFACGFFVTMSLNPNMEKIFSNMLCQLDKEKYSHVTKASWGEAQLIKRNTGIPSKQEILDVAKEVGGVYQLKPLSPAVSRKLFYQKIFGAEGRCPVQLAVVSEGILKKCGGVPLAIITIASLLASKNDRDNILEYWSKVYHSIGSGLEDNLHVNNMRKILSVSYYNLPPHLRACLLYLSCYPEDTNIGNKDVIWKWICEGFVRAEHMKTLHVVGMEYLNELWNKSLIQPISNCDNMPWDYCLHDMVLDLITFLSNEEQFMTSLGDQQPMLVPHKIRRLSLQSIKQEYFKLISNADLSHVRSLIVSKQAFSLLPNLSSFPVLRVLDLSGCDQVDNRHCRDICNTLHLRYLNLHRTSISEIPEEIGNLQFLLVLDITKTRLREVPSTFVQLQQLVDLCVGPGMRLPDDFGNLKTLQSIWPHIYVMSPTMLRNMGGLTKLRHLSIRFHEWDESYQKSFELCLSNLVNLRSITVRVYEGVMDSKCENLSPGPQQLEDIDMNRSVANSVPIWMSSLSFLSSLDIKLKTLGHKDLQILGNMPSLSDLTLWVNEPTQDRHERLVIDNCYPFHCLTFLKLMANNMEVAFAQGPMQKLQKLRFGFGVRKTVDQFGNFDFGLEKISVEHLDV

Coil: coil
41-62 coiled-coil

IMFLKAELESMEAALLDVSEAP

Coil: coil
132-153 coiled-coil

IKDIKSRIKEISERRDRYKVDN

superfamily: SSF52540
161-377 P-loop containing nucleoside triphosphate hydrolases

PTVDSLRLSALYKKMTELVGIEEKSDELVKMLMEGDKQELKIVSIVGFGGLGKTTLAKVVYEKLKVQFACGFFVTMSLNPNMEKIFSNMLCQLDKEKYSHVTKASWGEAQLIKRNTGIPSKQEILDVAKEVGGVYQLKPLSPAVSRKLFYQKIFGAEGRCPVQLAVVSEGILKKCGGVPLAIITIASLLASKNDRDNILEYWSKVYHSIGSGLEDNL

HMMPfam: PF00931
IPR002182
182-260 NB-ARC,NBS
NB-ARC

EEKSDELVKMLMEGDKQELKIVSIVGFGGLGKTTLAKVVYEKLKVQFACGFFVTMSLNPNMEKIFSNMLCQLDKEKYSH

FPrintScan: PR00364
IPR000767
202-217 DISEASERSIST
Disease resistance protein

IVSIVGFGGLGKTTLA

HMMPfam: PF00931
IPR002182
285-432 NB-ARC,NBS
NB-ARC

LDVAKEVGGVYQLKPLSPAVSRKLFYQKIFGAEGRCPVQLAVVSEGILKKCGGVPLAIITIASLLASKNDRDNILEYWSKVYHSIGSGLEDNLHVNNMRKILSVSYYNLPPHLRACLLYLSCYPEDTNIGNKDVIWKWICEGFVRAEH

FPrintScan: PR00364
IPR000767
335-349 DISEASERSIST
Disease resistance protein

CGGVPLAIITIASLL

Gene3D: G3DSA:3.80.10.10
496-773 no description

LVPHKIRRLSLQSIKQEYFKLISNADLSHVRSLIVSKQAFSLLPNLSSFPVLRVLDLSGCDQVDNRHCRDICNTLHLRYLNLHRTSISEIPEEIGNLQFLLVLDITKTRLREVPSTFVQLQQLVDLCVGPGMRLPDDFGNLKTLQSIWPHIYVMSPTMLRNMGGLTKLRHLSIRFHEWDESYQKSFELCLSNLVNLRSITVRVYEGVMDSKCENLSPGPQQLEDIDMNRSVANSVPIWMSSLSFLSSLDIKLKTLGHKDLQILGNMPSLSDLTLWVNE

superfamily: SSF52047
499-820 RNI-like,LRR

HKIRRLSLQSIKQEYFKLISNADLSHVRSLIVSKQAFSLLPNLSSFPVLRVLDLSGCDQVDNRHCRDICNTLHLRYLNLHRTSISEIPEEIGNLQFLLVLDITKTRLREVPSTFVQLQQLVDLCVGPGMRLPDDFGNLKTLQSIWPHIYVMSPTMLRNMGGLTKLRHLSIRFHEWDESYQKSFELCLSNLVNLRSITVRVYEGVMDSKCENLSPGPQQLEDIDMNRSVANSVPIWMSSLSFLSSLDIKLKTLGHKDLQILGNMPSLSDLTLWVNEPTQDRHERLVIDNCYPFHCLTFLKLMANNMEVAFAQGPMQKLQKLRF

FPrintScan: PR00364
IPR000767
542-558 DISEASERSIST
Disease resistance protein

SSFPVLRVLDLSGCDQV

Seg: seg
876-890 seg

NNPTLKLTTDKLNTK

Seg: seg
1026-1030 seg

TTTTT

Seg: seg
1114-1120 seg

PAPAPPA


List of References




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox