PRGDB00049902 (Os11g0550100)

From PRG Wiki
Jump to: navigation, search
Os11g0550100
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 115485858 (NM_001074605)
Gene Class NL
Domain Type LRR, NBS, LRR, LRR, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa (japonica cultivar-group) Os11g0550100 (Os11g0550100) mRNA, partial cds.

DNA Sequence

GACCAACCGTTGATAGCCTTGTATAAAAGGGTAAACGAGTTTGTTGGCATCGATGAGAAGAGCGATGAGCTTGTAAGAATGCTAATGGGGACAGGCGAGTCATCGATAAGAAAAAGAAAAAGGGATGTGAGTGAAGAGTCGAAGCAGAAATTGAAGATAGTTTCGATTGTCGGAGTTGGAGGATTAGGAAAGACGACTCTGGCTAATGTTGTGTATGAGAGGCTTAAAACACAATTCTATTGCTTTGCCTTTGTTCCCGTCTCTCTTACTCCTAACATGGAGAAGATATTCAAGAATATGCTCCATCAGTTTGATAAGAAAAAGTATCGGAACATCAATGAGGTAACATGGGATGAAGCACAACTCATCGCAGAACTGAGAGAATTCCTTAGAAACAAAAGGTACTTAATTGTCATTGATGATATATGGGATATATCTGCCTGGGAAAAGATCAAGTGTTCTTTTGTTGATAGTGAAAATGGAAGTGGAATAATCACAACAACTCGCAATGTTGATGTTGCAAAAGAAGTTGGTGGTGTTTATCAACTAAAACCTCTTTGTCATGTTGACTCAAGGAAATTGTTTAATCTGAGAATATTTGGTGCTGAAGACAAATGTCCTCCTCAGTTGGCTGAATTGTCAGAGAGAATTTTGAAGAAATGTAGCGGAGTACCCTTGGCTATCATTACCATAGCGAGTATGTTGGCCAGTAAAATAGAGAATGAAAACGCACATGAAGATGATTTCAAGCAGTTATCTATTTCGAACTTGTCGCATGTCAGGTCACTAATTTTTTTCAAAGGCTTCAATTCATTTCCTGCCTACTCAAGCTTCCCACTATTACGTGTATTGAACTTAAGTGGCTGCCAGAAAGTGGATAACAATCACTGCAAGGATATTTGCTTGTACTGGTTGCACCTAAGGTATTTGAACCTGTCCAGGACATCTGTTACAGAGATCCCGAGAGAGATCGAGAATCTACAATCTTTACAGGTACTGTGCATAAATGGCATCGAAATAGAAGATTTGCCATCCACCTTTGTTCGACTAGGACAAATTTTGTACCTCAATGTCTACTTGAAAACCCGAATACCAGATGGATTTGGGAGTCTAAAGTATCTGCAAGAACTTAAAGGAAGAATCC


Protein sequences

Name Description Sequence
hypothetical protein Os11g0550100 [Oryza sativa (japonica cultivar-group)].

DQPLIALYKRVNEFVGIDEKSDELVRMLMGTGESSIRKRKRDVSEESKQKLKIVSIVGVGGLGKTTLANVVYERLKTQFYCFAFVPVSLTPNMEKIFKNMLHQFDKKKYRNINEVTWDEAQLIAELREFLRNKRYLIVIDDIWDISAWEKIKCSFVDSENGSGIITTTRNVDVAKEVGGVYQLKPLCHVDSRKLFNLRIFGAEDKCPPQLAELSERILKKCSGVPLAIITIASMLASKIENENAHEDDFKQLSISNLSHVRSLIFFKGFNSFPAYSSFPLLRVLNLSGCQKVDNNHCKDICLYWLHLRYLNLSRTSVTEIPREIENLQSLQVLCINGIEIEDLPSTFVRLGQILYLNVYLKTRIPDGFGSLKYLQELKGRI

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
1-377 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

DQPLIALYKRVNEFVGIDEKSDELVRMLMGTGESSIRKRKRDVSEESKQKLKIVSIVGVGGLGKTTLANVVYERLKTQFYCFAFVPVSLTPNMEKIFKNMLHQFDKKKYRNINEVTWDEAQLIAELREFLRNKRYLIVIDDIWDISAWEKIKCSFVDSENGSGIITTTRNVDVAKEVGGVYQLKPLCHVDSRKLFNLRIFGAEDKCPPQLAELSERILKKCSGVPLAIITIASMLASKIENENAHEDDFKQLSISNLSHVRSLIFFKGFNSFPAYSSFPLLRVLNLSGCQKVDNNHCKDICLYWLHLRYLNLSRTSVTEIPREIENLQSLQVLCINGIEIEDLPSTFVRLGQILYLNVYLKTRIPDGFGSLKYLQEL

HMMPanther: PTHR23155:SF204
1-377 OS11G0550100 PROTEIN (FRAGMENT),OS11G0550100 PROTEIN (FRAGMENT)

DQPLIALYKRVNEFVGIDEKSDELVRMLMGTGESSIRKRKRDVSEESKQKLKIVSIVGVGGLGKTTLANVVYERLKTQFYCFAFVPVSLTPNMEKIFKNMLHQFDKKKYRNINEVTWDEAQLIAELREFLRNKRYLIVIDDIWDISAWEKIKCSFVDSENGSGIITTTRNVDVAKEVGGVYQLKPLCHVDSRKLFNLRIFGAEDKCPPQLAELSERILKKCSGVPLAIITIASMLASKIENENAHEDDFKQLSISNLSHVRSLIFFKGFNSFPAYSSFPLLRVLNLSGCQKVDNNHCKDICLYWLHLRYLNLSRTSVTEIPREIENLQSLQVLCINGIEIEDLPSTFVRLGQILYLNVYLKTRIPDGFGSLKYLQEL

superfamily: SSF52540
1-264 P-loop containing nucleoside triphosphate hydrolases

DQPLIALYKRVNEFVGIDEKSDELVRMLMGTGESSIRKRKRDVSEESKQKLKIVSIVGVGGLGKTTLANVVYERLKTQFYCFAFVPVSLTPNMEKIFKNMLHQFDKKKYRNINEVTWDEAQLIAELREFLRNKRYLIVIDDIWDISAWEKIKCSFVDSENGSGIITTTRNVDVAKEVGGVYQLKPLCHVDSRKLFNLRIFGAEDKCPPQLAELSERILKKCSGVPLAIITIASMLASKIENENAHEDDFKQLSISNLSHVRSLI

Gene3D: G3DSA:3.40.50.300
41-177 no description

RDVSEESKQKLKIVSIVGVGGLGKTTLANVVYERLKTQFYCFAFVPVSLTPNMEKIFKNMLHQFDKKKYRNINEVTWDEAQLIAELREFLRNKRYLIVIDDIWDISAWEKIKCSFVDSENGSGIITTTRNVDVAKEV

HMMPfam: PF00931
IPR002182
44-253 NB-ARC,NBS
NB-ARC

SEESKQKLKIVSIVGVGGLGKTTLANVVYERLKTQFYCFAFVPVSLTPNMEKIFKNMLHQFDKKKYRNINEVTWDEAQLIAELREFLRNKRYLIVIDDIWDISAWEKIKCSFVDSENGSGIITTTRNVDVAKEVGGVYQLKPLCHVDSRKLFNLRIFGAEDKCPPQLAELSERILKKCSGVPLAIITIASMLASKIENENAHEDDFKQLS

FPrintScan: PR00364
IPR000767
53-68 DISEASERSIST
Disease resistance protein

IVSIVGVGGLGKTTLA

FPrintScan: PR00364
IPR000767
129-143 DISEASERSIST
Disease resistance protein

FLRNKRYLIVIDDIW

FPrintScan: PR00364
IPR000767
221-235 DISEASERSIST
Disease resistance protein

CSGVPLAIITIASML

superfamily: SSF52047
247-377 RNI-like,LRR

DDFKQLSISNLSHVRSLIFFKGFNSFPAYSSFPLLRVLNLSGCQKVDNNHCKDICLYWLHLRYLNLSRTSVTEIPREIENLQSLQVLCINGIEIEDLPSTFVRLGQILYLNVYLKTRIPDGFGSLKYLQEL

Gene3D: G3DSA:3.80.10.10
249-377 no description

FKQLSISNLSHVRSLIFFKGFNSFPAYSSFPLLRVLNLSGCQKVDNNHCKDICLYWLHLRYLNLSRTSVTEIPREIENLQSLQVLCINGIEIEDLPSTFVRLGQILYLNVYLKTRIPDGFGSLKYLQEL

HMMPfam: PF00560
IPR001611
306-327 LRR_1
Leucine-rich repeat

HLRYLNLSRTSVTEIPREIENL

FPrintScan: PR00364
IPR000767
325-341 DISEASERSIST
Disease resistance protein

ENLQSLQVLCINGIEIE


List of References




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox