PRGDB00049909 (Os11g0266500)

From PRG Wiki
Jump to: navigation, search
Os11g0266500
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 115485044 (NM_001074198)
Gene Class NL
Domain Type LRR, NBS, LRR, LRR, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa (japonica cultivar-group) Os11g0266500 (Os11g0266500) mRNA, partial cds.

DNA Sequence

TTGCTTGTTGATTCCCGGTTGCCAGCACTCTATTCTGGTTTAGATGAGCTTGTAGGAATCAAGGGTCCAAGGGATTGTATAATCAAGTTGCTAACTTATGAAGCTGATAGTGGCCCATCAAGACAGCAACTCAAAGTAGTGTCCATTGTGGGATGTGGAGGTCTGGGCAAGACAACACTTGCCAATCAAGTCTATAAGGAAATCAATGGCCAATTTGATTGTAAGGCTTTTGTGTCTATGTCCCAGAAACCAGACATGAGGAAGATCTTAATGGATCTACTATCTCAAATACTGGGGAATGGTAGCCCCATGTGCTTTGATGAACAGCGACTCATTGACAAGCTTCGGGAGTTCCTAAAAGATAAGAGGTACCTGATCGTTATTGATGATATTTGGAGCACATCAGCATGGGAGATTGTGAAGTCTGCATTTCCTGATAATAATCTTCGCAGCAGAATAATTACAACAACGCGCATCATGGATGTAGCTAAATCATGTTCTGCTAATCTCCAGGAATATGTTTACACCATCAAACCACTTAATCATCAAGACTCTAGCAAGCTGTTTGTTAAAAAAATTTTCCCTTCTGGGTGTGGTGTTCCTCAACATCTGAAAGAAGTTTCGAATGCAATACTGAAAAAATGTGGTGGTTTGCCACTGGCTATACTTATTATAGCTGGTTTGTTGGCTAGTAAGTATGATAGGAAGGATGAGTGGGAGGCAGTGCATAATTCTATTGGCTCTGAACTTGGCAAAAATCATACTTTGGAAGGATTCAGAAGGATTTTGATGCTTAGTTTTTATGACCTGCCTCATGATTTGAAAACCTGCTTCTTATATCTAAGTATATTCCCGGAGGATGACCTGATTGTAAGAAAACAATTGGTGTGGAAATGGGTTGCGGAAGGGTTTATTAGAAAAGTGCGTGGTAAAAGACCAGATCAAGTTGCAGAGAGCTACTTTTACGATCTTATCAATAGAAACATGATCCAAGCAGTGGGTGTTCAGTACAAAGGTAACATATATGGTTGTCGAGTTCATGATTTAGTGCTTGACCTTATCAGATCTCTATCAGCACAAATCAACTTTGTTATCGCGATTGATGATAAAGGGTATGAATCTTCTCCTAGGAAGATTCGTCGGCTGTCCTTGCAAGCTAGTAATTTGGAAGATCAAGAAATGCAGAAACTTGTGAGTAATCAATCCCATATCCGCTCACTCATTATGTTCAGGGCCTTTAAGAAAGCACCTGATCTTTTCAAGTTCCATGCTCTGCGTATTTTGGATTTATCCGAGTGCAATTGTTTGGAGGACCACCACATTACATGTATAGTGAATATGTTTCAGCTGAGGTATCTGAGCCTCCCTTGCAGAATCACTGAACTCCCCGAGCAAACCGGGAACTTGCAACATCTAGAGGTACTGAACATCAGGCGTTGCATGATCAAAACATTGCCAGAACCCATTGTTAAACTTGGGAAACTCATGTGCCTACACGTGAAGTCTGGGGTGAAACTGCCGGATGAGATTGGGAGAATGCAAGCTCTCCAGGAGCTGGAGAGTATCTCCATCCCATGTAACTCTGTGAGGTTAATTGAGGAGATTGGTAGGCTGACAAGATTGCGAAGACTTACTGTTGAAACAACAAGCACTACTGAGAAAATGGGAGACCAAGAAGTGAGGTTCAGGGAAATGTTGGTCAGTTCCCTCACCGAGTTGGGCAGAAATGGCCTTGAGTCACTCTGTATCAGCTACCCTCATGGACAGAACTTCATCCTGGATTCATTGTTTGGCTCTGGCTGCTCTCTTCCAAAGTTTCATGAGCTTGACATAAAGAATTACCTTTGTTGGGTTCCAAGGTGGATAACTATGCTTAGTAGCCTTGTGCACTTATGCCTATCCATGTATGATATTGACGAGGAAGATATGCGAGTTCTGAATGGCATCTCCACCCTGCTATTTCTCCATTTAGAATTAAGGAATCCACCTGAAGAGAGGCTAGTCATTGGTTGCGATGGACTCAGACATCTGAACGAGCTACATGTGTTCTGCCAACATTCCACAATGCCATTGACGTTCGCGCCTGGAGCAATGCCAGAGCTCCACCGTTTACGCCTCGAATTCGGGGCGAGGGAGACGTTGCGCATGTATGGTGATTTTGATTTCGGCATCGAGCATCTTTCGGGACTCCGGGATATCAGAGTTGACATTAACTACTACTCTGGTGGCACTGACATGGATGCTTCCATCATCCATCCAAACCGCCCCTTACATGATGTCCGAATGCATGTCACCATGATGTTTACCCTGAAGGAGGCTGCTCAGTCGGTTGGGCTCCAAAGCGCCACGAAAGAATTGAATTTAGGGACGGATTTTCAGCGCACTTTCGTCCAAATTGAAGACCTTGATAATCCAGAAGTTCTGCGAAAACTACAGCAGCTATTATCACCTGAGTCTTCGACACGGAACCAGTAG


Protein sequences

Name Description Sequence
hypothetical protein Os11g0266500 [Oryza sativa (japonica cultivar-group)].

LLVDSRLPALYSGLDELVGIKGPRDCIIKLLTYEADSGPSRQQLKVVSIVGCGGLGKTTLANQVYKEINGQFDCKAFVSMSQKPDMRKILMDLLSQILGNGSPMCFDEQRLIDKLREFLKDKRYLIVIDDIWSTSAWEIVKSAFPDNNLRSRIITTTRIMDVAKSCSANLQEYVYTIKPLNHQDSSKLFVKKIFPSGCGVPQHLKEVSNAILKKCGGLPLAILIIAGLLASKYDRKDEWEAVHNSIGSELGKNHTLEGFRRILMLSFYDLPHDLKTCFLYLSIFPEDDLIVRKQLVWKWVAEGFIRKVRGKRPDQVAESYFYDLINRNMIQAVGVQYKGNIYGCRVHDLVLDLIRSLSAQINFVIAIDDKGYESSPRKIRRLSLQASNLEDQEMQKLVSNQSHIRSLIMFRAFKKAPDLFKFHALRILDLSECNCLEDHHITCIVNMFQLRYLSLPCRITELPEQTGNLQHLEVLNIRRCMIKTLPEPIVKLGKLMCLHVKSGVKLPDEIGRMQALQELESISIPCNSVRLIEEIGRLTRLRRLTVETTSTTEKMGDQEVRFREMLVSSLTELGRNGLESLCISYPHGQNFILDSLFGSGCSLPKFHELDIKNYLCWVPRWITMLSSLVHLCLSMYDIDEEDMRVLNGISTLLFLHLELRNPPEERLVIGCDGLRHLNELHVFCQHSTMPLTFAPGAMPELHRLRLEFGARETLRMYGDFDFGIEHLSGLRDIRVDINYYSGGTDMDASIIHPNRPLHDVRMHVTMMFTLKEAAQSVGLQSATKELNLGTDFQRTFVQIEDLDNPEVLRKLQQLLSPESSTRNQ

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF202
1-780 PTHR23155:SF202,OS11G0266500 PROTEIN (FRAGMENT)

LLVDSRLPALYSGLDELVGIKGPRDCIIKLLTYEADSGPSRQQLKVVSIVGCGGLGKTTLANQVYKEINGQFDCKAFVSMSQKPDMRKILMDLLSQILGNGSPMCFDEQRLIDKLREFLKDKRYLIVIDDIWSTSAWEIVKSAFPDNNLRSRIITTTRIMDVAKSCSANLQEYVYTIKPLNHQDSSKLFVKKIFPSGCGVPQHLKEVSNAILKKCGGLPLAILIIAGLLASKYDRKDEWEAVHNSIGSELGKNHTLEGFRRILMLSFYDLPHDLKTCFLYLSIFPEDDLIVRKQLVWKWVAEGFIRKVRGKRPDQVAESYFYDLINRNMIQAVGVQYKGNIYGCRVHDLVLDLIRSLSAQINFVIAIDDKGYESSPRKIRRLSLQASNLEDQEMQKLVSNQSHIRSLIMFRAFKKAPDLFKFHALRILDLSECNCLEDHHITCIVNMFQLRYLSLPCRITELPEQTGNLQHLEVLNIRRCMIKTLPEPIVKLGKLMCLHVKSGVKLPDEIGRMQALQELESISIPCNSVRLIEEIGRLTRLRRLTVETTSTTEKMGDQEVRFREMLVSSLTELGRNGLESLCISYPHGQNFILDSLFGSGCSLPKFHELDIKNYLCWVPRWITMLSSLVHLCLSMYDIDEEDMRVLNGISTLLFLHLELRNPPEERLVIGCDGLRHLNELHVFCQHSTMPLTFAPGAMPELHRLRLEFGARETLRMYGDFDFGIEHLSGLRDIRVDINYYSGGTDMDASIIHPNRPLHDVRMHVTMMFTLKEAAQSVGLQ

superfamily: SSF52540
1-254 SSF52540

LLVDSRLPALYSGLDELVGIKGPRDCIIKLLTYEADSGPSRQQLKVVSIVGCGGLGKTTLANQVYKEINGQFDCKAFVSMSQKPDMRKILMDLLSQILGNGSPMCFDEQRLIDKLREFLKDKRYLIVIDDIWSTSAWEIVKSAFPDNNLRSRIITTTRIMDVAKSCSANLQEYVYTIKPLNHQDSSKLFVKKIFPSGCGVPQHLKEVSNAILKKCGGLPLAILIIAGLLASKYDRKDEWEAVHNSIGSELGKNH

HMMPanther: PTHR23155
1-780 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LLVDSRLPALYSGLDELVGIKGPRDCIIKLLTYEADSGPSRQQLKVVSIVGCGGLGKTTLANQVYKEINGQFDCKAFVSMSQKPDMRKILMDLLSQILGNGSPMCFDEQRLIDKLREFLKDKRYLIVIDDIWSTSAWEIVKSAFPDNNLRSRIITTTRIMDVAKSCSANLQEYVYTIKPLNHQDSSKLFVKKIFPSGCGVPQHLKEVSNAILKKCGGLPLAILIIAGLLASKYDRKDEWEAVHNSIGSELGKNHTLEGFRRILMLSFYDLPHDLKTCFLYLSIFPEDDLIVRKQLVWKWVAEGFIRKVRGKRPDQVAESYFYDLINRNMIQAVGVQYKGNIYGCRVHDLVLDLIRSLSAQINFVIAIDDKGYESSPRKIRRLSLQASNLEDQEMQKLVSNQSHIRSLIMFRAFKKAPDLFKFHALRILDLSECNCLEDHHITCIVNMFQLRYLSLPCRITELPEQTGNLQHLEVLNIRRCMIKTLPEPIVKLGKLMCLHVKSGVKLPDEIGRMQALQELESISIPCNSVRLIEEIGRLTRLRRLTVETTSTTEKMGDQEVRFREMLVSSLTELGRNGLESLCISYPHGQNFILDSLFGSGCSLPKFHELDIKNYLCWVPRWITMLSSLVHLCLSMYDIDEEDMRVLNGISTLLFLHLELRNPPEERLVIGCDGLRHLNELHVFCQHSTMPLTFAPGAMPELHRLRLEFGARETLRMYGDFDFGIEHLSGLRDIRVDINYYSGGTDMDASIIHPNRPLHDVRMHVTMMFTLKEAAQSVGLQ

Gene3D: G3DSA:3.40.50.300
40-164 G3DSA:3.40.50.300

SRQQLKVVSIVGCGGLGKTTLANQVYKEINGQFDCKAFVSMSQKPDMRKILMDLLSQILGNGSPMCFDEQRLIDKLREFLKDKRYLIVIDDIWSTSAWEIVKSAFPDNNLRSRIITTTRIMDVAK

HMMPfam: PF00931
IPR002182
42-308 NB-ARC,NBS
NB-ARC

QQLKVVSIVGCGGLGKTTLANQVYKEINGQFDCKAFVSMSQKPDMRKILMDLLSQILGNGSPMCFDEQRLIDKLREFLKDKRYLIVIDDIWSTSAWEIVKSAFPDNNLRSRIITTTRIMDVAKSCSANLQEYVYTIKPLNHQDSSKLFVKKIFPSGCGVPQHLKEVSNAILKKCGGLPLAILIIAGLLASKYDRKDEWEAVHNSIGSELGKNHTLEGFRRILMLSFYDLPHDLKTCFLYLSIFPEDDLIVRKQLVWKWVAEGFIRKV

FPrintScan: PR00364
IPR000767
46-61 DISEASERSIST
Disease resistance protein

VVSIVGCGGLGKTTLA

FPrintScan: PR00364
IPR000767
118-132 DISEASERSIST
Disease resistance protein

FLKDKRYLIVIDDIW

FPrintScan: PR00364
IPR000767
215-229 DISEASERSIST
Disease resistance protein

CGGLPLAILIIAGLL

superfamily: SSF52058
345-742 SSF52058,LRR

RVHDLVLDLIRSLSAQINFVIAIDDKGYESSPRKIRRLSLQASNLEDQEMQKLVSNQSHIRSLIMFRAFKKAPDLFKFHALRILDLSECNCLEDHHITCIVNMFQLRYLSLPCRITELPEQTGNLQHLEVLNIRRCMIKTLPEPIVKLGKLMCLHVKSGVKLPDEIGRMQALQELESISIPCNSVRLIEEIGRLTRLRRLTVETTSTTEKMGDQEVRFREMLVSSLTELGRNGLESLCISYPHGQNFILDSLFGSGCSLPKFHELDIKNYLCWVPRWITMLSSLVHLCLSMYDIDEEDMRVLNGISTLLFLHLELRNPPEERLVIGCDGLRHLNELHVFCQHSTMPLTFAPGAMPELHRLRLEFGARETLRMYGDFDFGIEHLSGLRDIRVDINYYSG

Gene3D: G3DSA:3.80.10.10
376-549 G3DSA:3.80.10.10

PRKIRRLSLQASNLEDQEMQKLVSNQSHIRSLIMFRAFKKAPDLFKFHALRILDLSECNCLEDHHITCIVNMFQLRYLSLPCRITELPEQTGNLQHLEVLNIRRCMIKTLPEPIVKLGKLMCLHVKSGVKLPDEIGRMQALQELESISIPCNSVRLIEEIGRLTRLRRLTVETT

FPrintScan: PR00364
IPR000767
420-436 DISEASERSIST
Disease resistance protein

FKFHALRILDLSECNCL

Gene3D: G3DSA:3.80.10.10
594-707 G3DSA:3.80.10.10

DSLFGSGCSLPKFHELDIKNYLCWVPRWITMLSSLVHLCLSMYDIDEEDMRVLNGISTLLFLHLELRNPPEERLVIGCDGLRHLNELHVFCQHSTMPLTFAPGAMPELHRLRLE


List of References




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox