PRGDB00049910 (Os11g0265900)

From PRG Wiki
Jump to: navigation, search
Os11g0265900
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 115485038 (NM_001074195)
Gene Class NL
Domain Type LRR, LRR, NBS, LRR, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa (japonica cultivar-group) Os11g0265900 (Os11g0265900) mRNA, complete cds.

DNA Sequence

ATGGCGGGTGCACTGGTGAGCGCCTCTACGGGGGTCATGGAGTCTCTCCTTGGCAAGCTATCCAGTATGTTGGAGAAAGAGTACGCCAAGAAGAAAGCGGTAGAGAAGGATGTGCTGTTCCTGCGAAACGAGCTGAGCAGCATGAACACCGTGATGCAGAAGTACGCGATGTTGAGTGAGCCCGACTTGCAAGTGAAGGCTTGGATGAAAGAGGTAAGGGAGCTGGCCTACGACATCGAGGACACCATTGACGCTTTCATGGCTCGGAGTGAAAAATCCAATGAGCCTACAGGTATCAGAGGATTTATCATCAACAATATCCTGAAACTGAGAGAGCTGCTCTCAAGCTGTACTATTTCTCAAGAGATTGAAAAACTCAAGAACCAAGTTCTCGAGGTGAACGATCGTAGAAAAAGGTATAAGCTTGATGTATCTGTGTCCATGGGTACCGGCTGTGAATCAATTGACCCTCGCCTGCCAGCGTTTTATTCCGAGGTAGGTGGACTTGTCGGGATCGATGGGCCGAGGGACAAAATTATCAAGTTGCTAAGGGAGAATGCAGCTGATGAAGATTGTGGATTTGTGAATCGACTTAAGATGGTGTCTATCGCAGGGTTTGGAGGTTTGGGGAAAACTACTCTTGCCAAACAAGTTTATGAGAAAATCAAATGGCAGTTTGATTGTGCTGCTTTCGTGTTTGTATCTCAAATCCCAGATATGAAGAGGGTTCTTTTGGATTTGCTTTGTGGACTTGGGGCTTCTGGTAATACATGGGATGATGAGAAGCAACTCATTGACAAGATCAGAGAATTTCTTCATGACAAGAGGTATATAATTGTCATTGATGATATCTGGAGCATATCTTCTTGGGAGATCTTGAAGTGTGTATTGCCTGAGAACAATTCTGGCAGTAGAATAATTACAACTACACGTATTCTTGACGTATCCATGATATGTTGCTCTACTTTCAATGGAAGTATTTACCGCATCAAACCATTAAGTGACGACGACTCCAGAAGGTTGTTTTGTAGAAGAATTTTCCACGGTGAGCATTCGTGTCCATCACATCTAGAAGAGCTTTCAAAAGCAATTTTAAGAAAATGTGGTGGTTTGCCATTGGCCATACTTCATATTGCTAGTTTGTTGGCAACCAAATCTAACACAAAGGAAGAGTGGGAGTTGGTGCTAAATTCAATTGGCTCAGCACTTGAAAATAGCCATACTCTACAAGGTCTGAAAAAGATACTGTTACTCAGTTTCTATGATTTACCACCACAATTGAAGACTTGCTTACTATATCTCAGTATATATCCAGAAGATTGCATGATCAACTCCAAAGAGTTGATAAGGAAATGGATAGCTGAAGGATTTATCGCGGAAGACAGTGGGAAGAGATTGGACCAAGTAGCAGAGAGTTATCTTAATGATCTTATCAACAGAAGCATGATCTTACCTTTCGACATTACTCATGCTGATGGTGTACAATATTATCAAGTCCATGACGTTGTCCTTAACATTATCATATCTATGTCGAAAGAAGAGAATTTTGTCACGATAATAGATGGGCATAAGTGCAGTTCTTTGCAGGAAAAGATCCGTCGAGTATCCCTCCAGTTCAATGATTCAGAAGATGTTGTAGTGCCAACAAACATAACAAACAGAAGTTGTGTCCGTTCACTCAGTATATTTGGGATTACTAAGCAAGTGCCATATTTTATGGATCTTCAATCTTTGCGAGTGTTGGACTTAGGTTATTGTACATTGTTACAGAATCAGCACATTGAATGTTTAGGAAGTATGCTTCAACTTAGGTATCTGGTTCTCCATTCTCAATTAATCACTGAACTTCCTGATGAAATTGGGAACTTGCAACATCTAGAGATGTTAGATGTCACATTATGTTCCATACAAGCTCTTCCAGATACCATTGTTCGATTACAGAAACTCGTGTGTCTATATGTGAGTACTAAAGTGAAACTACCAGAAATGATTGGAACTATGCAATGTTTAGAGGAGCTGTTCCACATATCAAGCAACTCTATAAGATTGGCTGGAGATCTTAAATGTCTGAAAAAACTGAGAGATCTTGCAATAGCTGTTGAAGACCCTGTTGGGACAAAGAGCTCTACATTGAGATACAGGGAAGTAGTTCGGTCATCCCTTACTGAATTGGGCAGACACAACCTGCAGTCACTCTCACTGAATTACAAAGGTGATGAGAATTTCATTCTGGATTCGTCGATGGGTTCATGCTTCTCAACTCAGCGTCTCCGGAAACTTATCATTGGGAAAACTCTTTCCAGGGTGCCAGAGTGGATGAGTATATTTGACAATCTCACACACTTACAACTGTGCATCTCAAGGATGGAACAGAGTGATATTAACATACTCAAAGGAATTGACTCTCTGATCTTTCTCCGCCTCGTATTTACAGGGCATGCTCCTGATGGAAGGATAGTCATCGACAACCGAGGATTTCAAGCTCTCAAGGAATTATATCTTCTATGTTTCATTCCTGGGATGTGGCCAGTGTTCGAGCCAGGAGCTATGCAAGAATTACAGAAGTATCACCTCACTTTCAAGCTACAGAAAGTACATTGCAAGAATAGTGTTTTGGACTTTGGTCTCCAGCATCTTTCAAGCCTCCAGCACATAAGTGCGATAATTATTCCATCTGGTGCTACCAGTGAGGACACATTGGTTGCAGAGGATGCCATCAGGAGTGCTACAAGTATCCATCCCAACCAACCAATAGCTGAAATTTTTGTCGAGTAA


Protein sequences

Name Description Sequence
hypothetical protein Os11g0265900 [Oryza sativa (japonica cultivar-group)].

MAGALVSASTGVMESLLGKLSSMLEKEYAKKKAVEKDVLFLRNELSSMNTVMQKYAMLSEPDLQVKAWMKEVRELAYDIEDTIDAFMARSEKSNEPTGIRGFIINNILKLRELLSSCTISQEIEKLKNQVLEVNDRRKRYKLDVSVSMGTGCESIDPRLPAFYSEVGGLVGIDGPRDKIIKLLRENAADEDCGFVNRLKMVSIAGFGGLGKTTLAKQVYEKIKWQFDCAAFVFVSQIPDMKRVLLDLLCGLGASGNTWDDEKQLIDKIREFLHDKRYIIVIDDIWSISSWEILKCVLPENNSGSRIITTTRILDVSMICCSTFNGSIYRIKPLSDDDSRRLFCRRIFHGEHSCPSHLEELSKAILRKCGGLPLAILHIASLLATKSNTKEEWELVLNSIGSALENSHTLQGLKKILLLSFYDLPPQLKTCLLYLSIYPEDCMINSKELIRKWIAEGFIAEDSGKRLDQVAESYLNDLINRSMILPFDITHADGVQYYQVHDVVLNIIISMSKEENFVTIIDGHKCSSLQEKIRRVSLQFNDSEDVVVPTNITNRSCVRSLSIFGITKQVPYFMDLQSLRVLDLGYCTLLQNQHIECLGSMLQLRYLVLHSQLITELPDEIGNLQHLEMLDVTLCSIQALPDTIVRLQKLVCLYVSTKVKLPEMIGTMQCLEELFHISSNSIRLAGDLKCLKKLRDLAIAVEDPVGTKSSTLRYREVVRSSLTELGRHNLQSLSLNYKGDENFILDSSMGSCFSTQRLRKLIIGKTLSRVPEWMSIFDNLTHLQLCISRMEQSDINILKGIDSLIFLRLVFTGHAPDGRIVIDNRGFQALKELYLLCFIPGMWPVFEPGAMQELQKYHLTFKLQKVHCKNSVLDFGLQHLSSLQHISAIIIPSGATSEDTLVAEDAIRSATSIHPNQPIAEIFVE

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF201
9-890 PTHR23155:SF201,OS11G0265900 PROTEIN

STGVMESLLGKLSSMLEKEYAKKKAVEKDVLFLRNELSSMNTVMQKYAMLSEPDLQVKAWMKEVRELAYDIEDTIDAFMARSEKSNEPTGIRGFIINNILKLRELLSSCTISQEIEKLKNQVLEVNDRRKRYKLDVSVSMGTGCESIDPRLPAFYSEVGGLVGIDGPRDKIIKLLRENAADEDCGFVNRLKMVSIAGFGGLGKTTLAKQVYEKIKWQFDCAAFVFVSQIPDMKRVLLDLLCGLGASGNTWDDEKQLIDKIREFLHDKRYIIVIDDIWSISSWEILKCVLPENNSGSRIITTTRILDVSMICCSTFNGSIYRIKPLSDDDSRRLFCRRIFHGEHSCPSHLEELSKAILRKCGGLPLAILHIASLLATKSNTKEEWELVLNSIGSALENSHTLQGLKKILLLSFYDLPPQLKTCLLYLSIYPEDCMINSKELIRKWIAEGFIAEDSGKRLDQVAESYLNDLINRSMILPFDITHADGVQYYQVHDVVLNIIISMSKEENFVTIIDGHKCSSLQEKIRRVSLQFNDSEDVVVPTNITNRSCVRSLSIFGITKQVPYFMDLQSLRVLDLGYCTLLQNQHIECLGSMLQLRYLVLHSQLITELPDEIGNLQHLEMLDVTLCSIQALPDTIVRLQKLVCLYVSTKVKLPEMIGTMQCLEELFHISSNSIRLAGDLKCLKKLRDLAIAVEDPVGTKSSTLRYREVVRSSLTELGRHNLQSLSLNYKGDENFILDSSMGSCFSTQRLRKLIIGKTLSRVPEWMSIFDNLTHLQLCISRMEQSDINILKGIDSLIFLRLVFTGHAPDGRIVIDNRGFQALKELYLLCFIPGMWPVFEPGAMQELQKYHLTFKLQKVHCKNSVLDFGLQHLSSLQHISAIII

HMMPanther: PTHR23155
9-890 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

STGVMESLLGKLSSMLEKEYAKKKAVEKDVLFLRNELSSMNTVMQKYAMLSEPDLQVKAWMKEVRELAYDIEDTIDAFMARSEKSNEPTGIRGFIINNILKLRELLSSCTISQEIEKLKNQVLEVNDRRKRYKLDVSVSMGTGCESIDPRLPAFYSEVGGLVGIDGPRDKIIKLLRENAADEDCGFVNRLKMVSIAGFGGLGKTTLAKQVYEKIKWQFDCAAFVFVSQIPDMKRVLLDLLCGLGASGNTWDDEKQLIDKIREFLHDKRYIIVIDDIWSISSWEILKCVLPENNSGSRIITTTRILDVSMICCSTFNGSIYRIKPLSDDDSRRLFCRRIFHGEHSCPSHLEELSKAILRKCGGLPLAILHIASLLATKSNTKEEWELVLNSIGSALENSHTLQGLKKILLLSFYDLPPQLKTCLLYLSIYPEDCMINSKELIRKWIAEGFIAEDSGKRLDQVAESYLNDLINRSMILPFDITHADGVQYYQVHDVVLNIIISMSKEENFVTIIDGHKCSSLQEKIRRVSLQFNDSEDVVVPTNITNRSCVRSLSIFGITKQVPYFMDLQSLRVLDLGYCTLLQNQHIECLGSMLQLRYLVLHSQLITELPDEIGNLQHLEMLDVTLCSIQALPDTIVRLQKLVCLYVSTKVKLPEMIGTMQCLEELFHISSNSIRLAGDLKCLKKLRDLAIAVEDPVGTKSSTLRYREVVRSSLTELGRHNLQSLSLNYKGDENFILDSSMGSCFSTQRLRKLIIGKTLSRVPEWMSIFDNLTHLQLCISRMEQSDINILKGIDSLIFLRLVFTGHAPDGRIVIDNRGFQALKELYLLCFIPGMWPVFEPGAMQELQKYHLTFKLQKVHCKNSVLDFGLQHLSSLQHISAIII

superfamily: SSF52540
152-407 SSF52540

CESIDPRLPAFYSEVGGLVGIDGPRDKIIKLLRENAADEDCGFVNRLKMVSIAGFGGLGKTTLAKQVYEKIKWQFDCAAFVFVSQIPDMKRVLLDLLCGLGASGNTWDDEKQLIDKIREFLHDKRYIIVIDDIWSISSWEILKCVLPENNSGSRIITTTRILDVSMICCSTFNGSIYRIKPLSDDDSRRLFCRRIFHGEHSCPSHLEELSKAILRKCGGLPLAILHIASLLATKSNTKEEWELVLNSIGSALENSH

Gene3D: G3DSA:3.40.50.300
173-310 G3DSA:3.40.50.300

DGPRDKIIKLLRENAADEDCGFVNRLKMVSIAGFGGLGKTTLAKQVYEKIKWQFDCAAFVFVSQIPDMKRVLLDLLCGLGASGNTWDDEKQLIDKIREFLHDKRYIIVIDDIWSISSWEILKCVLPENNSGSRIITTT

HMMPfam: PF00931
IPR002182
196-460 NB-ARC,NBS
NB-ARC

NRLKMVSIAGFGGLGKTTLAKQVYEKIKWQFDCAAFVFVSQIPDMKRVLLDLLCGLGASGNTWDDEKQLIDKIREFLHDKRYIIVIDDIWSISSWEILKCVLPENNSGSRIITTTRILDVSMICCSTFNGSIYRIKPLSDDDSRRLFCRRIFHGEHSCPSHLEELSKAILRKCGGLPLAILHIASLLATKSNTKEEWELVLNSIGSALENSHTLQGLKKILLLSFYDLPPQLKTCLLYLSIYPEDCMINSKELIRKWIAEGFIAE

FPrintScan: PR00364
IPR000767
200-215 DISEASERSIST
Disease resistance protein

MVSIAGFGGLGKTTLA

FPrintScan: PR00364
IPR000767
271-285 DISEASERSIST
Disease resistance protein

FLHDKRYIIVIDDIW

FPrintScan: PR00364
IPR000767
368-382 DISEASERSIST
Disease resistance protein

CGGLPLAILHIASLL

Gene3D: G3DSA:3.80.10.10
522-698 G3DSA:3.80.10.10

GHKCSSLQEKIRRVSLQFNDSEDVVVPTNITNRSCVRSLSIFGITKQVPYFMDLQSLRVLDLGYCTLLQNQHIECLGSMLQLRYLVLHSQLITELPDEIGNLQHLEMLDVTLCSIQALPDTIVRLQKLVCLYVSTKVKLPEMIGTMQCLEELFHISSNSIRLAGDLKCLKKLRDLAI

superfamily: SSF52047
530-834 SSF52047,LRR

EKIRRVSLQFNDSEDVVVPTNITNRSCVRSLSIFGITKQVPYFMDLQSLRVLDLGYCTLLQNQHIECLGSMLQLRYLVLHSQLITELPDEIGNLQHLEMLDVTLCSIQALPDTIVRLQKLVCLYVSTKVKLPEMIGTMQCLEELFHISSNSIRLAGDLKCLKKLRDLAIAVEDPVGTKSSTLRYREVVRSSLTELGRHNLQSLSLNYKGDENFILDSSMGSCFSTQRLRKLIIGKTLSRVPEWMSIFDNLTHLQLCISRMEQSDINILKGIDSLIFLRLVFTGHAPDGRIVIDNRGFQALKELYL

FPrintScan: PR00364
IPR000767
573-589 DISEASERSIST
Disease resistance protein

MDLQSLRVLDLGYCTLL


List of References




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox