PRGDB00049911 (Os11g0258500)

From PRG Wiki
Jump to: navigation, search
Os11g0258500
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 115484992 (NM_001074172)
Gene Class NL
Domain Type LRR, NBS, LRR, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa (japonica cultivar-group) Os11g0258500 (Os11g0258500) mRNA, complete cds.

DNA Sequence

ATGGTGAGTGTTGCTACTGGGGTACTCAGCTCGGTTCTCGGAAAGCTCCCTGCCCTGGTAGAGAGGCAGTGCAACAACAGCTTCAAGGGTGTGAATGAGGAGATCCTCACCATGAAGCTCGAGCTGCAAAGCATGAATGCTTTTCTCCTCAAGCTGGCTGACATGGATGATCTAGATATCCAGGTCAAGGAATGGAGGAACCAAATCAGAGAGCTGTCCTACGATATCGAGGACTGCATCGACGACTTTATTCATCAGATGGATGGTGGCTCAAGCAGAGTTCACAAGGGTTTCTTCCAGAAGAGCATTCACAAGCTGAGGACACTTGGAGCTCGTAATGAGATTGCTGATCAAATCCTAAAGTTGAAGGCGCGTGTTGACGATGCAAGTGAGCGGCAAAAGAGGTATAACTTCAATGGTACCATCTCAAGTTCTATTGATGTGGTACCCCTTGACCCTCGGTTGCCAGCACTTTTTGCAGAGGCAGATGCCCTAGTAGGTATTGATGAACCAGCAGAAGAGCTCATCAACTGGCTAACTAAAGGAGGGGAAAAGTTGGAGTCAAGATTAAGTGTGGTGTCTGTTGTGGGTCTTGGAGGGTTGGGCAAGACTACTCTTGCTCGTCAAGTATATAACAAAATTGGAGGGCAGTTTGATTGCCAAGCATTTGTGTCCATCTCCCAAAAACCTGACATGAGGAAAATATTTCAGAAAATGCTGAATGATATCACAAGGATTGAACATGCTAGTCTAGCATGGGATGAAGAGCAACTCATGGGCAGATTGAGAGCTTTGGATGAGGAGCAACTCATCAACAAATTGAGAGAAACCCTCACGGGTAGAAGGTACTTTATTGTAATTGATGATCTATGGAGTACATTAGCATGGAGAACAATCAGATGTGCATTTCCAGAAATTGCCAAGTCATGTTGCTATCCAGACCTCAACAATGTGTATGAACTGAAACCTCTTAGCAACAGTGATGCTAATAAATTGTTTATGAAAAGGATATTTGGTTCTGAAGATCAATGTCCATCTCAATTGAAACTAGTATCCAATGGCATCTTGAGAAAATGTGGCGGTTTACCATTGGCAATCATTAGTATAGCTAGTTTATTGGCTAATAATCCATGCACAAAAGAATTATGGGAGAGGTACCGAAATTCCATTGGCTCTCAATTTGAAAAGGATCCCAGTGTAAATGACATGCAGAGGATTCTATCTCTCAGTTATAATGACCTTCCGCACTATTTGAAGACATGCTTATTATACCTCAGTATATATCCGGAGGATTTCGTAATAAGGAGGACTCAATTGATACTGAGATGGATAGCAGAAGGATTCATAACAGCAAATGGCAGACAAAATTTAGAGGAAATAGCTGAGTACTATTTTAATGAACTAATCAATAGGAGCATGATCATACCAGTGAGCATCCAATATGATGGCAGAGTTGATGCTTGTCGAGTACATGATGTGATTTTTGATCTTATTATTTCCAAGTCAGCTGAAGAAAATTTCATCACAGTATTTGGTTACCAGAATCATGCCTTTGGACCACAAGACAAGATTCGTCGACTGGTTCATTACCATGGTCAAGAAGAAATTATGGTGATGTCAGATATGAATGTTTTGAATGTTCGATCACTCACTACTTATGGATCCACTGAAAATGTGCTGCCTATTTCAGACTTTCAAGCTCTTCGTACAATTAGCATTGAATGCAATGATCAATTAGAAAACCATCACCTAAATGGCATACAGAAATTGTTTTGTCTTAAATACCTAAGGTTGAACAGAGTAAGCATCAGCAAACTCCCAGAGCAAATAGGGGAACTACAGCAACTTGAGACAATAGATCTGACACAGACAATGATAAAGGAATTACCCAAGAGTATTGTGAAGTTGAAAAGGTTGCTGTTTTTACTTGCCGATGAAGTAAGTCTGCCAGCAGGAGTAGGGAACATGAAGGCTTTACAGAAACTTTATCATATGAAAGTTGACAACAGCATCTCATCAAATACCTTGCATGAACTACAAAGATTGACTGAACTAAGGTATCTTGGGATAATTTGGTGCGTTAATGATATGTATGCTGGTGGTAAAACTCACATAGATAACTTTGTTCCATCCATCAGTACACTGTGCAAACTCAAGCTTCAGTACCTGCATGTTCAATGCTGTACTGAAAATGGTTCGTCTCTCGATTTCTTGTTGAATTCTTGGTTCACTGCTCCTAATCCCCTCCGATATTTTGGGATGAGCTCAAACTATTATTTTCCTAGAATTCCAGAGTGGATGGCTATGCTCTCTAGCGTCACCTTCCTGAATATCAATATTAGTCATGTTGGGGAGGAAGCTTTTCAGATCCTTGGCAAATTACCTTCTCTTCTAGCTCTCAGGATATGGACAAAAGGAGTAGCCCCCAATGAAAAGCTCATCATCCGCAACAGAGGGTTTCTCTATCTTAAACAGTTCGTGTTTTACTCCTGCAATATTGAAATGAATCCATTAGTATTTGAGGCTGGGGCAATGCAAAATCTTGAAAGGTTTCGCTTTAACTTAAAAGCACGAGAAACAAGAAATCCATGCAGACAATTTTTTCTCAGCATCCAGCAGATGTCCTCTCTCAAGCATCTCCTTGTGTTGATAGATTGTAGAGATGCAAAGGCTCATGAGGTGGAGGCTAAAGAGGCTGCCATCAGGGAGGCAACCAATCACCTTCGCAGCCATATCAATATTGAAATCAACACAAACTGGACATGGAAGATGGTAAAAGATGATGATGATGTTGGGATCAAATGCAAGGAAGAGGATAGTATGAAGCATCCGCGGGAGTGGGAGAAGGATGTTTAA


Protein sequences

Name Description Sequence
hypothetical protein Os11g0258500 [Oryza sativa (japonica cultivar-group)].

MVSVATGVLSSVLGKLPALVERQCNNSFKGVNEEILTMKLELQSMNAFLLKLADMDDLDIQVKEWRNQIRELSYDIEDCIDDFIHQMDGGSSRVHKGFFQKSIHKLRTLGARNEIADQILKLKARVDDASERQKRYNFNGTISSSIDVVPLDPRLPALFAEADALVGIDEPAEELINWLTKGGEKLESRLSVVSVVGLGGLGKTTLARQVYNKIGGQFDCQAFVSISQKPDMRKIFQKMLNDITRIEHASLAWDEEQLMGRLRALDEEQLINKLRETLTGRRYFIVIDDLWSTLAWRTIRCAFPEIAKSCCYPDLNNVYELKPLSNSDANKLFMKRIFGSEDQCPSQLKLVSNGILRKCGGLPLAIISIASLLANNPCTKELWERYRNSIGSQFEKDPSVNDMQRILSLSYNDLPHYLKTCLLYLSIYPEDFVIRRTQLILRWIAEGFITANGRQNLEEIAEYYFNELINRSMIIPVSIQYDGRVDACRVHDVIFDLIISKSAEENFITVFGYQNHAFGPQDKIRRLVHYHGQEEIMVMSDMNVLNVRSLTTYGSTENVLPISDFQALRTISIECNDQLENHHLNGIQKLFCLKYLRLNRVSISKLPEQIGELQQLETIDLTQTMIKELPKSIVKLKRLLFLLADEVSLPAGVGNMKALQKLYHMKVDNSISSNTLHELQRLTELRYLGIIWCVNDMYAGGKTHIDNFVPSISTLCKLKLQYLHVQCCTENGSSLDFLLNSWFTAPNPLRYFGMSSNYYFPRIPEWMAMLSSVTFLNINISHVGEEAFQILGKLPSLLALRIWTKGVAPNEKLIIRNRGFLYLKQFVFYSCNIEMNPLVFEAGAMQNLERFRFNLKARETRNPCRQFFLSIQQMSSLKHLLVLIDCRDAKAHEVEAKEAAIREATNHLRSHINIEINTNWTWKMVKDDDDVGIKCKEEDSMKHPREWEKDV

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017
18-690 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

ALVERQCNNSFKGVNEEILTMKLELQSMNAFLLKLADMDDLDIQVKEWRNQIRELSYDIEDCIDDFIHQMDGGSSRVHKGFFQKSIHKLRTLGARNEIADQILKLKARVDDASERQKRYNFNGTISSSIDVVPLDPRLPALFAEADALVGIDEPAEELINWLTKGGEKLESRLSVVSVVGLGGLGKTTLARQVYNKIGGQFDCQAFVSISQKPDMRKIFQKMLNDITRIEHASLAWDEEQLMGRLRALDEEQLINKLRETLTGRRYFIVIDDLWSTLAWRTIRCAFPEIAKSCCYPDLNNVYELKPLSNSDANKLFMKRIFGSEDQCPSQLKLVSNGILRKCGGLPLAIISIASLLANNPCTKELWERYRNSIGSQFEKDPSVNDMQRILSLSYNDLPHYLKTCLLYLSIYPEDFVIRRTQLILRWIAEGFITANGRQNLEEIAEYYFNELINRSMIIPVSIQYDGRVDACRVHDVIFDLIISKSAEENFITVFGYQNHAFGPQDKIRRLVHYHGQEEIMVMSDMNVLNVRSLTTYGSTENVLPISDFQALRTISIECNDQLENHHLNGIQKLFCLKYLRLNRVSISKLPEQIGELQQLETIDLTQTMIKELPKSIVKLKRLLFLLADEVSLPAGVGNMKALQKLYHMKVDNSISSNTLHELQRLTELRYLGI

HMMPanther: PTHR11017:SF126
18-690 PTHR11017:SF126,OS11G0237600 PROTEIN

ALVERQCNNSFKGVNEEILTMKLELQSMNAFLLKLADMDDLDIQVKEWRNQIRELSYDIEDCIDDFIHQMDGGSSRVHKGFFQKSIHKLRTLGARNEIADQILKLKARVDDASERQKRYNFNGTISSSIDVVPLDPRLPALFAEADALVGIDEPAEELINWLTKGGEKLESRLSVVSVVGLGGLGKTTLARQVYNKIGGQFDCQAFVSISQKPDMRKIFQKMLNDITRIEHASLAWDEEQLMGRLRALDEEQLINKLRETLTGRRYFIVIDDLWSTLAWRTIRCAFPEIAKSCCYPDLNNVYELKPLSNSDANKLFMKRIFGSEDQCPSQLKLVSNGILRKCGGLPLAIISIASLLANNPCTKELWERYRNSIGSQFEKDPSVNDMQRILSLSYNDLPHYLKTCLLYLSIYPEDFVIRRTQLILRWIAEGFITANGRQNLEEIAEYYFNELINRSMIIPVSIQYDGRVDACRVHDVIFDLIISKSAEENFITVFGYQNHAFGPQDKIRRLVHYHGQEEIMVMSDMNVLNVRSLTTYGSTENVLPISDFQALRTISIECNDQLENHHLNGIQKLFCLKYLRLNRVSISKLPEQIGELQQLETIDLTQTMIKELPKSIVKLKRLLFLLADEVSLPAGVGNMKALQKLYHMKVDNSISSNTLHELQRLTELRYLGI

superfamily: SSF52540
148-397 SSF52540

VVPLDPRLPALFAEADALVGIDEPAEELINWLTKGGEKLESRLSVVSVVGLGGLGKTTLARQVYNKIGGQFDCQAFVSISQKPDMRKIFQKMLNDITRIEHASLAWDEEQLMGRLRALDEEQLINKLRETLTGRRYFIVIDDLWSTLAWRTIRCAFPEIAKSCCYPDLNNVYELKPLSNSDANKLFMKRIFGSEDQCPSQLKLVSNGILRKCGGLPLAIISIASLLANNPCTKELWERYRNSIGSQFEKD

Gene3D: G3DSA:3.40.50.300
166-292 G3DSA:3.40.50.300

VGIDEPAEELINWLTKGGEKLESRLSVVSVVGLGGLGKTTLARQVYNKIGGQFDCQAFVSISQKPDMRKIFQKMLNDITRIEHASLAWDEEQLMGRLRALDEEQLINKLRETLTGRRYFIVIDDLWS

HMMPfam: PF00931
IPR002182
170-452 NB-ARC,NBS
NB-ARC

EPAEELINWLTKGGEKLESRLSVVSVVGLGGLGKTTLARQVYNKIGGQFDCQAFVSISQKPDMRKIFQKMLNDITRIEHASLAWDEEQLMGRLRALDEEQLINKLRETLTGRRYFIVIDDLWSTLAWRTIRCAFPEIAKSCCYPDLNNVYELKPLSNSDANKLFMKRIFGSEDQCPSQLKLVSNGILRKCGGLPLAIISIASLLANNPCTKELWERYRNSIGSQFEKDPSVNDMQRILSLSYNDLPHYLKTCLLYLSIYPEDFVIRRTQLILRWIAEGFITAN

FPrintScan: PR00364
IPR000767
192-207 DISEASERSIST
Disease resistance protein

VVSVVGLGGLGKTTLA

FPrintScan: PR00364
IPR000767
277-291 DISEASERSIST
Disease resistance protein

TLTGRRYFIVIDDLW

FPrintScan: PR00364
IPR000767
359-373 DISEASERSIST
Disease resistance protein

CGGLPLAIISIASLL

superfamily: SSF52058
489-882 SSF52058,LRR

RVHDVIFDLIISKSAEENFITVFGYQNHAFGPQDKIRRLVHYHGQEEIMVMSDMNVLNVRSLTTYGSTENVLPISDFQALRTISIECNDQLENHHLNGIQKLFCLKYLRLNRVSISKLPEQIGELQQLETIDLTQTMIKELPKSIVKLKRLLFLLADEVSLPAGVGNMKALQKLYHMKVDNSISSNTLHELQRLTELRYLGIIWCVNDMYAGGKTHIDNFVPSISTLCKLKLQYLHVQCCTENGSSLDFLLNSWFTAPNPLRYFGMSSNYYFPRIPEWMAMLSSVTFLNINISHVGEEAFQILGKLPSLLALRIWTKGVAPNEKLIIRNRGFLYLKQFVFYSCNIEMNPLVFEAGAMQNLERFRFNLKARETRNPCRQFFLSIQQMSSLKHLLV

Gene3D: G3DSA:3.80.10.10
562-687 G3DSA:3.80.10.10

ISDFQALRTISIECNDQLENHHLNGIQKLFCLKYLRLNRVSISKLPEQIGELQQLETIDLTQTMIKELPKSIVKLKRLLFLLADEVSLPAGVGNMKALQKLYHMKVDNSISSNTLHELQRLTELRY

FPrintScan: PR00364
IPR000767
611-627 DISEASERSIST
Disease resistance protein

GELQQLETIDLTQTMIK

Gene3D: G3DSA:3.80.10.10
723-802 G3DSA:3.80.10.10

LHVQCCTENGSSLDFLLNSWFTAPNPLRYFGMSSNYYFPRIPEWMAMLSSVTFLNINISHVGEEAFQILGKLPSLLALRI


List of References




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox