PRGDB00049913 (Os11g0238700)

From PRG Wiki
Jump to: navigation, search
Os11g0238700
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 115484862 (NM_001074107)
Gene Class CNL
Domain Type LRR, NBS, LRR, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa (japonica cultivar-group) Os11g0238700 (Os11g0238700) mRNA, complete cds.

DNA Sequence

ATGGGAGGGGTTGTCGAGCAGATCGTGGTGAGCGCCCTAACGGGGGCGATGAGCCCTCTTCTCAGAAAACTCACCAACCTCATAGAGAAGAAGTACATGGAGGTCAAGGGCGTGAGGAAGAAGCTGGAACAGCTCACGAAGGAGCTAATGACCATCGGCATCGCGCTGGAGAAGTACGCGGCCATGGACAGTCCAGACGTGCAGGTGAAGGCCTGGATGGCGGAGATGCGCGAGTTGGCCTACGACATGGAGGATAGCATAGATCTCTTCACCTACCGTATCGACCATGAGCCAGCTGACACAACCAATGGAGTCAAGAGGGTTCTCCACAAGACCCTCCGCAAGGTGAAGAAGTTTCATCATCGCCACAAGTTTGCTAAGGAAATCGAGGAACTTCATGTTCTTGTAAATGAAGCGTACGAACGGCAAAAGAGGTATAGGATTGAAGAGGGCACTTCTAGCAAATTGTGTAGGGAGATTGATCCTCGGCTACCTGCCCTTTATGTGGAGAAGGAAAAACTCGTGGGCATCCAGGGTCCAATGAAGGAAATCATCAATTGGTTTGGTAGTGAGGAAGTGGAGCCAATAGGGCAGCGTAAGATTGTCTCTATTGTTGGACAAGGAGGTTTAGGAAAGACTACTCTCGCTAACCAGGTGTATCAGAAAATTAAAGGTCAATTCTCTTTTTCAGCTTTTGTGTCTGTATCGCAAAAGCCCAACATGGATAACCTTCTAAGGGAGTTGCTTTCTCAAATTAAGAGCAATGAACCAACGGAATCATATAGTGATCAACAACTTATCGACAAACTAAGAACATGTCTGAAAGATGAACGGTACCTTATTGTGATTGATGACATTTGGAAAAGGTCAGCATGGAAAACAATACAATGTGCTTTTCCTATAAACAAGCACGCAAGTAGAATAATCACAACAACGCGGATCAAAAGTGTAGCTCAATCTTGCTGCGGCGCTTCAGATGAGGGCTTTGTCTACCAGATGAAACCTCTTAACAAAAGTGACTCTGAAAATTTATTTCTCACAAGGACTTTTGGTGCTGAAAAAAAATGCCCCAGTCAGCTGGAAGGGATTATCAGTGATATACTTTATAAATGTGATGGTTTGCCTTTAGCCATTATTACTATAGCTAGCTTGTTAGCTGATAAACCAAGAACAAGGGAAGAATGGGAGAGAGTTCTGAATTATATTGTTTCTACTAGTGAGAAGGATAATGACCTGGAGGTAATGAACAAGATACTGTTTATGAGTTACAATGATCTACCACATCATATGAAAAGTTGTTTACTGCACCTCGGTACGTTTCCTGAGGATCACAAGATTGGTAAGGATGTGCTGGTATGGAGATGGATAGCTGAAGGATTCATAACAAAAAAACAAGGCTTTACTTTGCAGGAAGTTGCAGAGAGTTATTTCTACGAGCTGATAAATAGGAGCTTGGTCCAACACATACAGATCATGCCAAATGGAGAAGATGGATGTCGAGTCCATGATATAGTTTTGAACTTCATCATCCATCAGTCAACTGAAGAAAATTTTTTAACCAAGTTGGATTGTCAGGATCACCCATCTTCACGTAAACGGATTCGCCGGCTTTTAGTTGGGAACAAAGAAGAATATACAAGGGCAAAATCACAAGGAACCATGAATTCGTCTAACCTTCGTTCAATTAACATATACCATGTTGATGGCCATATGATGTCTCCTCTTTTAAACCTACCTACTCTTCGAGTGTTGAATCTAGAGCGTTGTGATCTCAGGAATAGTTATCTTGATTGCATTGTAGGTTTATTTCACCTAAGATACTTGGGGCTCCGTTGGTCAAGAATTGACTGCCTACCTGTCCAAATTGGGAAGCTAGAGTATCTGCAAACACTCGATTTACGCCATACTTCATTATTAGTGATGCCTGAAAGTATTGTTCAGCTCAAACGGTTGATGCGTCTTGTTGGACATCATCTCATATTACCGGATGGGTTCGGTAACATGGAATCTCTTCAAGAATTAGGGTTTTTAGGTTGTTGTAGAAGCTCCACAAATTTATTAAAATTTCAGAAAGATCTACAACTTTTGAGAAATTTGAGGGTGCTCAAAGTAAGGTTCTTGTCTGAAGGGGAAACAGGAAAAGAAGCAATGATACCATCCCTTTGCAAGCTTGGAGGAAACAACCTCCGGGAAGTCTATATTACCAGCTGCAATGGAAGTGGAGATTGTTTCGCAGATTCTTGGTGTCCTTCGCCGTGTTTCCTGGAAAAGTTTGTTTACAAGAGTAGTTGCAATATACATTACTTTTCCAGGTTTCCGAAGTGGATTCATCCCACACTCTCTAGATGTCTCACCTACTTGGATATCGACGTTAAACAAATGGAACGAGAACATGTACGTATTCTTGAAGATTTGCCTGCTCTTATTGTCCTACACCTAGACATAGGGGAAGCTCTCGTGTATGGAATCAGGATCAGCCATGGTGCATTCCAATGTTTGGCACGCCTACGTTTCTGCAACAGATCTGGACCTGGTTTGGTATTCAAAGGAGGCATGCCAAAGCTCGAATGGCTTAGCGTTGAATTCGGTGCAGAGAGGGCACAATCAACATATGGCAGTTTAGAGGTTGGCATCCGGCACATCACATCTCTCAAACATATCGACTTTTCTATCCTGGTGCTCACTGACGATATGGAGTGGAAAATCAAATCATCTATAAATAGCCAAGTCAAGATGCTTCCACAACGTCCTGAGATTAGTCGATCTATGCTACGGCAACGATCCCATGACCTTGATGAGTTGCTCTAA


Protein sequences

Name Description Sequence
hypothetical protein Os11g0238700 [Oryza sativa (japonica cultivar-group)].

MGGVVEQIVVSALTGAMSPLLRKLTNLIEKKYMEVKGVRKKLEQLTKELMTIGIALEKYAAMDSPDVQVKAWMAEMRELAYDMEDSIDLFTYRIDHEPADTTNGVKRVLHKTLRKVKKFHHRHKFAKEIEELHVLVNEAYERQKRYRIEEGTSSKLCREIDPRLPALYVEKEKLVGIQGPMKEIINWFGSEEVEPIGQRKIVSIVGQGGLGKTTLANQVYQKIKGQFSFSAFVSVSQKPNMDNLLRELLSQIKSNEPTESYSDQQLIDKLRTCLKDERYLIVIDDIWKRSAWKTIQCAFPINKHASRIITTTRIKSVAQSCCGASDEGFVYQMKPLNKSDSENLFLTRTFGAEKKCPSQLEGIISDILYKCDGLPLAIITIASLLADKPRTREEWERVLNYIVSTSEKDNDLEVMNKILFMSYNDLPHHMKSCLLHLGTFPEDHKIGKDVLVWRWIAEGFITKKQGFTLQEVAESYFYELINRSLVQHIQIMPNGEDGCRVHDIVLNFIIHQSTEENFLTKLDCQDHPSSRKRIRRLLVGNKEEYTRAKSQGTMNSSNLRSINIYHVDGHMMSPLLNLPTLRVLNLERCDLRNSYLDCIVGLFHLRYLGLRWSRIDCLPVQIGKLEYLQTLDLRHTSLLVMPESIVQLKRLMRLVGHHLILPDGFGNMESLQELGFLGCCRSSTNLLKFQKDLQLLRNLRVLKVRFLSEGETGKEAMIPSLCKLGGNNLREVYITSCNGSGDCFADSWCPSPCFLEKFVYKSSCNIHYFSRFPKWIHPTLSRCLTYLDIDVKQMEREHVRILEDLPALIVLHLDIGEALVYGIRISHGAFQCLARLRFCNRSGPGLVFKGGMPKLEWLSVEFGAERAQSTYGSLEVGIRHITSLKHIDFSILVLTDDMEWKIKSSINSQVKMLPQRPEISRSMLRQRSHDLDELL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017:SF126
27-914 OS11G0237600 PROTEIN,OS11G0237600 PROTEIN

LIEKKYMEVKGVRKKLEQLTKELMTIGIALEKYAAMDSPDVQVKAWMAEMRELAYDMEDSIDLFTYRIDHEPADTTNGVKRVLHKTLRKVKKFHHRHKFAKEIEELHVLVNEAYERQKRYRIEEGTSSKLCREIDPRLPALYVEKEKLVGIQGPMKEIINWFGSEEVEPIGQRKIVSIVGQGGLGKTTLANQVYQKIKGQFSFSAFVSVSQKPNMDNLLRELLSQIKSNEPTESYSDQQLIDKLRTCLKDERYLIVIDDIWKRSAWKTIQCAFPINKHASRIITTTRIKSVAQSCCGASDEGFVYQMKPLNKSDSENLFLTRTFGAEKKCPSQLEGIISDILYKCDGLPLAIITIASLLADKPRTREEWERVLNYIVSTSEKDNDLEVMNKILFMSYNDLPHHMKSCLLHLGTFPEDHKIGKDVLVWRWIAEGFITKKQGFTLQEVAESYFYELINRSLVQHIQIMPNGEDGCRVHDIVLNFIIHQSTEENFLTKLDCQDHPSSRKRIRRLLVGNKEEYTRAKSQGTMNSSNLRSINIYHVDGHMMSPLLNLPTLRVLNLERCDLRNSYLDCIVGLFHLRYLGLRWSRIDCLPVQIGKLEYLQTLDLRHTSLLVMPESIVQLKRLMRLVGHHLILPDGFGNMESLQELGFLGCCRSSTNLLKFQKDLQLLRNLRVLKVRFLSEGETGKEAMIPSLCKLGGNNLREVYITSCNGSGDCFADSWCPSPCFLEKFVYKSSCNIHYFSRFPKWIHPTLSRCLTYLDIDVKQMEREHVRILEDLPALIVLHLDIGEALVYGIRISHGAFQCLARLRFCNRSGPGLVFKGGMPKLEWLSVEFGAERAQSTYGSLEVGIRHITSLKHIDFSILVLTDDMEWKIKSSINSQVKMLP

HMMPanther: PTHR11017
27-914 FAMILY NOT NAMED,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LIEKKYMEVKGVRKKLEQLTKELMTIGIALEKYAAMDSPDVQVKAWMAEMRELAYDMEDSIDLFTYRIDHEPADTTNGVKRVLHKTLRKVKKFHHRHKFAKEIEELHVLVNEAYERQKRYRIEEGTSSKLCREIDPRLPALYVEKEKLVGIQGPMKEIINWFGSEEVEPIGQRKIVSIVGQGGLGKTTLANQVYQKIKGQFSFSAFVSVSQKPNMDNLLRELLSQIKSNEPTESYSDQQLIDKLRTCLKDERYLIVIDDIWKRSAWKTIQCAFPINKHASRIITTTRIKSVAQSCCGASDEGFVYQMKPLNKSDSENLFLTRTFGAEKKCPSQLEGIISDILYKCDGLPLAIITIASLLADKPRTREEWERVLNYIVSTSEKDNDLEVMNKILFMSYNDLPHHMKSCLLHLGTFPEDHKIGKDVLVWRWIAEGFITKKQGFTLQEVAESYFYELINRSLVQHIQIMPNGEDGCRVHDIVLNFIIHQSTEENFLTKLDCQDHPSSRKRIRRLLVGNKEEYTRAKSQGTMNSSNLRSINIYHVDGHMMSPLLNLPTLRVLNLERCDLRNSYLDCIVGLFHLRYLGLRWSRIDCLPVQIGKLEYLQTLDLRHTSLLVMPESIVQLKRLMRLVGHHLILPDGFGNMESLQELGFLGCCRSSTNLLKFQKDLQLLRNLRVLKVRFLSEGETGKEAMIPSLCKLGGNNLREVYITSCNGSGDCFADSWCPSPCFLEKFVYKSSCNIHYFSRFPKWIHPTLSRCLTYLDIDVKQMEREHVRILEDLPALIVLHLDIGEALVYGIRISHGAFQCLARLRFCNRSGPGLVFKGGMPKLEWLSVEFGAERAQSTYGSLEVGIRHITSLKHIDFSILVLTDDMEWKIKSSINSQVKMLP

Coil: coil
28-49 coiled-coil

IEKKYMEVKGVRKKLEQLTKEL

Seg: seg
114-127 seg

RKVKKFHHRHKFAK

superfamily: SSF52540
157-409 P-loop containing nucleoside triphosphate hydrolases

CREIDPRLPALYVEKEKLVGIQGPMKEIINWFGSEEVEPIGQRKIVSIVGQGGLGKTTLANQVYQKIKGQFSFSAFVSVSQKPNMDNLLRELLSQIKSNEPTESYSDQQLIDKLRTCLKDERYLIVIDDIWKRSAWKTIQCAFPINKHASRIITTTRIKSVAQSCCGASDEGFVYQMKPLNKSDSENLFLTRTFGAEKKCPSQLEGIISDILYKCDGLPLAIITIASLLADKPRTREEWERVLNYIVSTSEKD

Gene3D: G3DSA:3.40.50.300
176-302 no description

GIQGPMKEIINWFGSEEVEPIGQRKIVSIVGQGGLGKTTLANQVYQKIKGQFSFSAFVSVSQKPNMDNLLRELLSQIKSNEPTESYSDQQLIDKLRTCLKDERYLIVIDDIWKRSAWKTIQCAFPIN

HMMPfam: PF00931
IPR002182
181-465 NB-ARC,NBS
NB-ARC

MKEIINWFGSEEVEPIGQRKIVSIVGQGGLGKTTLANQVYQKIKGQFSFSAFVSVSQKPNMDNLLRELLSQIKSNEPTESYSDQQLIDKLRTCLKDERYLIVIDDIWKRSAWKTIQCAFPINKHASRIITTTRIKSVAQSCCGASDEGFVYQMKPLNKSDSENLFLTRTFGAEKKCPSQLEGIISDILYKCDGLPLAIITIASLLADKPRTREEWERVLNYIVSTSEKDNDLEVMNKILFMSYNDLPHHMKSCLLHLGTFPEDHKIGKDVLVWRWIAEGFITKKQ

FPrintScan: PR00364
IPR000767
201-216 DISEASERSIST
Disease resistance protein

IVSIVGQGGLGKTTLA

Seg: seg
227-236 seg

FSFSAFVSVS

FPrintScan: PR00364
IPR000767
273-287 DISEASERSIST
Disease resistance protein

CLKDERYLIVIDDIW

FPrintScan: PR00364
IPR000767
371-385 DISEASERSIST
Disease resistance protein

CDGLPLAIITIASLL

superfamily: SSF52047
521-840 RNI-like,LRR

KLDCQDHPSSRKRIRRLLVGNKEEYTRAKSQGTMNSSNLRSINIYHVDGHMMSPLLNLPTLRVLNLERCDLRNSYLDCIVGLFHLRYLGLRWSRIDCLPVQIGKLEYLQTLDLRHTSLLVMPESIVQLKRLMRLVGHHLILPDGFGNMESLQELGFLGCCRSSTNLLKFQKDLQLLRNLRVLKVRFLSEGETGKEAMIPSLCKLGGNNLREVYITSCNGSGDCFADSWCPSPCFLEKFVYKSSCNIHYFSRFPKWIHPTLSRCLTYLDIDVKQMEREHVRILEDLPALIVLHLDIGEALVYGIRISHGAFQCLARLRFCN

Seg: seg
574-586 seg

PLLNLPTLRVLNL

FPrintScan: PR00364
IPR000767
623-639 DISEASERSIST
Disease resistance protein

GKLEYLQTLDLRHTSLL

Gene3D: G3DSA:3.80.10.10
867-889 no description

AQSTYGSLEVGIRHITSLKHIDF


List of References




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox