PRGDB00049914 (Os11g0237900)

From PRG Wiki
Jump to: navigation, search
Os11g0237900
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 115484858 (NM_001074105)
Gene Class CNL
Domain Type LRR, NBS, LRR, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa (japonica cultivar-group) Os11g0237900 (Os11g0237900) mRNA, complete cds.

DNA Sequence

ATGGAGGCCCGGATCTGGGCACCTCCGAGGCGCGGTTGGTCCCTAGCCATTCGGCCCCACCGAGGGAGAAGAAGCCCTGCCGCCGCCGTCCTTGCGGCCGCCGTCTTTGCCGGCAGCCGCTCAGGCGACGGCGAGGCGGGGGAGAGGAGGGAGGAGGGTGGCGGGGGCGGGCGCTGGTCGCCGTCCGTGTCGCCTTGGGGAGAGCGACGCGGACGGGAGCGTGGTCTCTCTATTGCACCCTTACCAACAAACAAGCAGAAGGACAGGCGGTTGGTTGAGCTGATATTAAAGTGTAGAGGGTTGTTTGCAACTTTGCAAGGGAGGGAGATGGGAGGAGTTGGGGAGAAGATCATAATGAGTGCCTTGTTAGGGGTGATGAGCCCTTTGCTTGGCAAGCTAGGTAACCTGATTGAGAAAGAGTATGCTGAGCTAAAGGGCGCGAGGAAGAAGCTAGAGCAGCTCATGAAAGAACTCATGGCCATCAACCTTGCGCTGGAGAAGTACTCAGGCATGGAGAATTTTGATGTGCAAGTGAAGGCTTGGACAATAGAGATGCATGAGCTGGCCTATGACATGGAGGATAGCATAGATCTCTTCAGTTACTGCATAGACCACGAGCCAGTGAGCACCACCATGGGAGTCAAGAGGGTCATCCTCAAGATCCTTCGCAAGTTGAAGAAGATTCACCATCGACACAAGTTTGCTAAGCAAATGCATCAACTTCAAGTTCTTGCCAATGAAGCATACAATCGGCAAAAGAGATACAAGCTTGAAGAAGGCAGCTCTAGCAACTCTTTTGTGGAGATTGATCCTCGGTTGCCAGCACTCTATGTGGAAGTTCAAAAACTTGTGGGCATCGAGGGCCCAAGCAAAGAAATCATTGAACAGTTAATTGGTGAGGAACCTACGTGGCATCGTAGGGTTGTGTCCGTTGTCGGATCTGGAGGTTCAGGTAAGACTACCCTCGCTAAACAGGTGTATGAGAGAATCAGAGGTCAATTCTCTTGTGCAGCGTTTGTATCTGTATCACAAAAGCCTAACATAAATAACCTTCTGAGGGAGTTGCTCTCTCGAATTGGAAGCAACAGTGAAAGTTTAGGAGCAAGAGAATTATATAGTGACCAACAACTCATCGACAAGCTAAGAGCATGTCTTGAAAATGAAAGGTATCTTGTTGTGATTGATGACATATGGCAAAAGTCGGCATGGGAAACAATACAATGCGCTCTTCCTAAAAACAACCATGCAAGTAGAATAATCACAACAACACGCATCAAAAGTGTAGGTCAATTCTGTTGCACTTCAGATGAGGGCTTTGTTTACCAAATGAAACCTCTTACCAAAAGTGATTCTGAAAATTTATTTCTCAAAAGGACTTTTAGTTCTGAAGAAAATAGCCCCAGTCAGCTGCAGGAGGTTATCAATAAGATACTTTACAAATGTGATGGTTTGCCATTGGCTATTATTACTTTAGCTAGCTTGCTAGCTGATAAACCAAGAAGAAAGGAAGAATGGGAGAGAGTTCTAAATTATATAGGTTCTATGCCAAAAAAGGATAGTAAGCTGGAGGTAATGGATAAGATATTGTCTTTGAGTTACAACGATCTACCCCACCATATGAAAAATTGCTTCCTTTACCTGAGTACTTTTCCGGAGGATCATGAGATTCGCAAAGATATCTTGGTATGGAAATGGATAGCTGAAGGGTTCATCATCACAAAACAAGGGTTTACTTTGGAGGAAGTTGCAGAAAGCTACTTTTATGAGCTCATAAATAGGAGTTTGGTCCAACCTGTTAATATGGTACATGGGGCAATTGAACAGGGATGCAAAGTTCATGATATAGTACTCAATTTCATAATCTCTCGGTCAGTTGAAGATAATTTTTTGACTATGGTGGATGGTCAGGAACTCCCATCTCCAAAGTCAAGGATTCGACGTCTCTCTGTTTGGAACAAGCAAGAATTTCCAAGGTTTATATCGAAAGGAAGCATGAATTTGCCCTATATCCGTGCAATTAGTATATGCCATATTGATGGCTGGACAATGCCCTCAGTTTTAAACCTTCCTGTTCTTCGAGTGTTAGATCTAGAGGGTTGCCGTGCTTTGAGGAATGATCATCTTGATTGCATTGTAAGTTTATTTCATCTCAAATACCTGAGGCTTTCTAAGACAAGTATTGATAGGCTACCGGCCCAAATTGGGAAGCTTGAGTATTTGCAGATGCTCGATGTAAGCTCAACCCAAGTAAGATTGCTGCCAGAAAGTGTTATTCAGCTAAAGAGACTGATGCGCCTTGTTGGCAATGAACTCATACTGTCAGATGGGTTTGCTAACATGGAATCTCTTCAGGAGTTGGGGGTTCTTGATGCTTGCAACTGCTCCATAAATTTTGGGAAAGATCTTGAACTTCTGAGCAATCTGAGGGTGCTTCGAATAATGTTTAGGTGTGAAGAAATTACTAGTGATCCAGATGCTAGAAAGAAATCTTTGATGTCATCCCTCTGCAAACTTGGGGGTAACAGCCTTCGGTCTCTGTATTATCAGAGCTCTACCACCGGTGTCGATTGTTCAGCAGATTCATGGTGCCCTCCTCCTATTCTCCTCCAAAAGTTTGAGTACAGAGGTGTTCGCTACTTCTCCAGCTTTCCAAAATGGATCAAACACTCGCTCGTCGATCTCGCCTACTTGGATTTCAGGATTGAACGTATGGAAAGGAAAGATTTGCATGTTCTTGAAAGTTTGCCTGCACTAACTGTCCTATGCGTAACCGTGAAGCGAGTTCCTGAAGATGGACTTATGATCAGACACGGTGCATTCCAATGTCTAACACGCCTTGAATTTTGTAATACAGATGGACCTGGTTTGACGTTTGAAGCAGATATGACCAGGCTTGAGTGGCTTAAACTTGAATTCAATGCGGATAAAGCACAAGCAACATATGGCAGTTTAGTGGTTGGTATTCAGCACTTATGTTCTCTTAAATGTATTGATCTCACTATTGGGATGTTATCTGAAGATGAAAATGATCCACCGAAGGAGATTATCAAGTCTGTTATCGGTGACAAAATCAAGATGCTTCCCCATAATCCCAAGCAATACGGCGGGGTACTCATCTAG


Protein sequences

Name Description Sequence
hypothetical protein Os11g0237900 [Oryza sativa (japonica cultivar-group)].

MEARIWAPPRRGWSLAIRPHRGRRSPAAAVLAAAVFAGSRSGDGEAGERREEGGGGGRWSPSVSPWGERRGRERGLSIAPLPTNKQKDRRLVELILKCRGLFATLQGREMGGVGEKIIMSALLGVMSPLLGKLGNLIEKEYAELKGARKKLEQLMKELMAINLALEKYSGMENFDVQVKAWTIEMHELAYDMEDSIDLFSYCIDHEPVSTTMGVKRVILKILRKLKKIHHRHKFAKQMHQLQVLANEAYNRQKRYKLEEGSSSNSFVEIDPRLPALYVEVQKLVGIEGPSKEIIEQLIGEEPTWHRRVVSVVGSGGSGKTTLAKQVYERIRGQFSCAAFVSVSQKPNINNLLRELLSRIGSNSESLGARELYSDQQLIDKLRACLENERYLVVIDDIWQKSAWETIQCALPKNNHASRIITTTRIKSVGQFCCTSDEGFVYQMKPLTKSDSENLFLKRTFSSEENSPSQLQEVINKILYKCDGLPLAIITLASLLADKPRRKEEWERVLNYIGSMPKKDSKLEVMDKILSLSYNDLPHHMKNCFLYLSTFPEDHEIRKDILVWKWIAEGFIITKQGFTLEEVAESYFYELINRSLVQPVNMVHGAIEQGCKVHDIVLNFIISRSVEDNFLTMVDGQELPSPKSRIRRLSVWNKQEFPRFISKGSMNLPYIRAISICHIDGWTMPSVLNLPVLRVLDLEGCRALRNDHLDCIVSLFHLKYLRLSKTSIDRLPAQIGKLEYLQMLDVSSTQVRLLPESVIQLKRLMRLVGNELILSDGFANMESLQELGVLDACNCSINFGKDLELLSNLRVLRIMFRCEEITSDPDARKKSLMSSLCKLGGNSLRSLYYQSSTTGVDCSADSWCPPPILLQKFEYRGVRYFSSFPKWIKHSLVDLAYLDFRIERMERKDLHVLESLPALTVLCVTVKRVPEDGLMIRHGAFQCLTRLEFCNTDGPGLTFEADMTRLEWLKLEFNADKAQATYGSLVVGIQHLCSLKCIDLTIGMLSEDENDPPKEIIKSVIGDKIKMLPHNPKQYGGVLI

Domains

Domain Start-End Description Sequence

Seg: seg
27-58 seg

AAAVLAAAVFAGSRSGDGEAGERREEGGGGGR

HMMPanther: PTHR11017
134-1029 FAMILY NOT NAMED,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GNLIEKEYAELKGARKKLEQLMKELMAINLALEKYSGMENFDVQVKAWTIEMHELAYDMEDSIDLFSYCIDHEPVSTTMGVKRVILKILRKLKKIHHRHKFAKQMHQLQVLANEAYNRQKRYKLEEGSSSNSFVEIDPRLPALYVEVQKLVGIEGPSKEIIEQLIGEEPTWHRRVVSVVGSGGSGKTTLAKQVYERIRGQFSCAAFVSVSQKPNINNLLRELLSRIGSNSESLGARELYSDQQLIDKLRACLENERYLVVIDDIWQKSAWETIQCALPKNNHASRIITTTRIKSVGQFCCTSDEGFVYQMKPLTKSDSENLFLKRTFSSEENSPSQLQEVINKILYKCDGLPLAIITLASLLADKPRRKEEWERVLNYIGSMPKKDSKLEVMDKILSLSYNDLPHHMKNCFLYLSTFPEDHEIRKDILVWKWIAEGFIITKQGFTLEEVAESYFYELINRSLVQPVNMVHGAIEQGCKVHDIVLNFIISRSVEDNFLTMVDGQELPSPKSRIRRLSVWNKQEFPRFISKGSMNLPYIRAISICHIDGWTMPSVLNLPVLRVLDLEGCRALRNDHLDCIVSLFHLKYLRLSKTSIDRLPAQIGKLEYLQMLDVSSTQVRLLPESVIQLKRLMRLVGNELILSDGFANMESLQELGVLDACNCSINFGKDLELLSNLRVLRIMFRCEEITSDPDARKKSLMSSLCKLGGNSLRSLYYQSSTTGVDCSADSWCPPPILLQKFEYRGVRYFSSFPKWIKHSLVDLAYLDFRIERMERKDLHVLESLPALTVLCVTVKRVPEDGLMIRHGAFQCLTRLEFCNTDGPGLTFEADMTRLEWLKLEFNADKAQATYGSLVVGIQHLCSLKCIDLTIGMLSEDENDPPKEIIKSVIGDKIKMLPH

HMMPanther: PTHR11017:SF126
134-1029 OS11G0237600 PROTEIN,OS11G0237600 PROTEIN

GNLIEKEYAELKGARKKLEQLMKELMAINLALEKYSGMENFDVQVKAWTIEMHELAYDMEDSIDLFSYCIDHEPVSTTMGVKRVILKILRKLKKIHHRHKFAKQMHQLQVLANEAYNRQKRYKLEEGSSSNSFVEIDPRLPALYVEVQKLVGIEGPSKEIIEQLIGEEPTWHRRVVSVVGSGGSGKTTLAKQVYERIRGQFSCAAFVSVSQKPNINNLLRELLSRIGSNSESLGARELYSDQQLIDKLRACLENERYLVVIDDIWQKSAWETIQCALPKNNHASRIITTTRIKSVGQFCCTSDEGFVYQMKPLTKSDSENLFLKRTFSSEENSPSQLQEVINKILYKCDGLPLAIITLASLLADKPRRKEEWERVLNYIGSMPKKDSKLEVMDKILSLSYNDLPHHMKNCFLYLSTFPEDHEIRKDILVWKWIAEGFIITKQGFTLEEVAESYFYELINRSLVQPVNMVHGAIEQGCKVHDIVLNFIISRSVEDNFLTMVDGQELPSPKSRIRRLSVWNKQEFPRFISKGSMNLPYIRAISICHIDGWTMPSVLNLPVLRVLDLEGCRALRNDHLDCIVSLFHLKYLRLSKTSIDRLPAQIGKLEYLQMLDVSSTQVRLLPESVIQLKRLMRLVGNELILSDGFANMESLQELGVLDACNCSINFGKDLELLSNLRVLRIMFRCEEITSDPDARKKSLMSSLCKLGGNSLRSLYYQSSTTGVDCSADSWCPPPILLQKFEYRGVRYFSSFPKWIKHSLVDLAYLDFRIERMERKDLHVLESLPALTVLCVTVKRVPEDGLMIRHGAFQCLTRLEFCNTDGPGLTFEADMTRLEWLKLEFNADKAQATYGSLVVGIQHLCSLKCIDLTIGMLSEDENDPPKEIIKSVIGDKIKMLPH

Coil: coil
137-165 coiled-coil

IEKEYAELKGARKKLEQLMKELMAINLAL

Seg: seg
214-233 seg

VKRVILKILRKLKKIHHRHK

superfamily: SSF52540
266-519 P-loop containing nucleoside triphosphate hydrolases

FVEIDPRLPALYVEVQKLVGIEGPSKEIIEQLIGEEPTWHRRVVSVVGSGGSGKTTLAKQVYERIRGQFSCAAFVSVSQKPNINNLLRELLSRIGSNSESLGARELYSDQQLIDKLRACLENERYLVVIDDIWQKSAWETIQCALPKNNHASRIITTTRIKSVGQFCCTSDEGFVYQMKPLTKSDSENLFLKRTFSSEENSPSQLQEVINKILYKCDGLPLAIITLASLLADKPRRKEEWERVLNYIGSMPKKD

Gene3D: G3DSA:3.40.50.300
280-427 no description

VQKLVGIEGPSKEIIEQLIGEEPTWHRRVVSVVGSGGSGKTTLAKQVYERIRGQFSCAAFVSVSQKPNINNLLRELLSRIGSNSESLGARELYSDQQLIDKLRACLENERYLVVIDDIWQKSAWETIQCALPKNNHASRIITTTRIKS

HMMPfam: PF00931
IPR002182
291-575 NB-ARC,NBS
NB-ARC

KEIIEQLIGEEPTWHRRVVSVVGSGGSGKTTLAKQVYERIRGQFSCAAFVSVSQKPNINNLLRELLSRIGSNSESLGARELYSDQQLIDKLRACLENERYLVVIDDIWQKSAWETIQCALPKNNHASRIITTTRIKSVGQFCCTSDEGFVYQMKPLTKSDSENLFLKRTFSSEENSPSQLQEVINKILYKCDGLPLAIITLASLLADKPRRKEEWERVLNYIGSMPKKDSKLEVMDKILSLSYNDLPHHMKNCFLYLSTFPEDHEIRKDILVWKWIAEGFIITKQ

FPrintScan: PR00364
IPR000767
308-323 DISEASERSIST
Disease resistance protein

VVSVVGSGGSGKTTLA

Seg: seg
308-318 seg

VVSVVGSGGSG

FPrintScan: PR00364
IPR000767
384-398 DISEASERSIST
Disease resistance protein

CLENERYLVVIDDIW

FPrintScan: PR00364
IPR000767
481-495 DISEASERSIST
Disease resistance protein

CDGLPLAIITLASLL

superfamily: SSF52058
595-1000 L domain-like,LRR

LVQPVNMVHGAIEQGCKVHDIVLNFIISRSVEDNFLTMVDGQELPSPKSRIRRLSVWNKQEFPRFISKGSMNLPYIRAISICHIDGWTMPSVLNLPVLRVLDLEGCRALRNDHLDCIVSLFHLKYLRLSKTSIDRLPAQIGKLEYLQMLDVSSTQVRLLPESVIQLKRLMRLVGNELILSDGFANMESLQELGVLDACNCSINFGKDLELLSNLRVLRIMFRCEEITSDPDARKKSLMSSLCKLGGNSLRSLYYQSSTTGVDCSADSWCPPPILLQKFEYRGVRYFSSFPKWIKHSLVDLAYLDFRIERMERKDLHVLESLPALTVLCVTVKRVPEDGLMIRHGAFQCLTRLEFCNTDGPGLTFEADMTRLEWLKLEFNADKAQATYGSLVVGIQHLCSLKCIDLT

FPrintScan: PR00364
IPR000767
687-703 DISEASERSIST
Disease resistance protein

LNLPVLRVLDLEGCRAL

Gene3D: G3DSA:3.80.10.10
868-974 no description

LLQKFEYRGVRYFSSFPKWIKHSLVDLAYLDFRIERMERKDLHVLESLPALTVLCVTVKRVPEDGLMIRHGAFQCLTRLEFCNTDGPGLTFEADMTRLEWLKLEFNA


List of References




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox