PRGDB00049915 (Os11g0237600)

From PRG Wiki
Jump to: navigation, search
Os11g0237600
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 115484854 (NM_001074103)
Gene Class CNL
Domain Type NBS, LRR, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa (japonica cultivar-group) Os11g0237600 (Os11g0237600) mRNA, complete cds.

DNA Sequence

ATGGCAGGAGTTGGGGAGAAGATGATGGTTAGCGCCTTGACGGGGGTGATGAGCCCCGTGCTCGGCAAGCTCGCCGGCCTCATGGAGCAGGAGTATTCCAAGCTCAGGGGCGTGAGGAAGAAGATGGAGCAGCTCAGGAAGGAGCTCATCACAATCAACCTCGCGGTGGAGCAGTACGCGTCCATGGATGACGACCCGGACAAGCTGAGGAGGGCATGGGTAAAGGAGATCCGGGAGCTCGCCTACGACATCGAGGACTGCATAGATCTGTTCGTCCACCGCTCCAACCACGAATTCTCCGCCGGCGGTGGCGTCAGGAGGCTCCTCCTCGACAGCATCAGTAAGCTTCGGGGGCTTCACCATCGCCACAAGTTCGCCGCCCAGATCCAGCAGCTCAAGAACACCGCCGGCGAAATCCACGAGAGGAACTTGAAATACAAGGCCGATGGCTGCAGCTCTGCTGCAACACCACCACATACAGAGATCGATCCTCGCTTGCCGGCGCTCTACGAGGAGGCGGAAAGGCTCGTGGGGATCGAGCGCCAGATGGAAGAAATCATCACTAGGTTTCTGGTTCTGGAGAGCACACCGACGAACAAGTGCAGCATCATTTCGATTGTTGGTCAGGGAGGCTTAGGCAAGACCACCCTTGCTCGTCAGGTGTACCTGAGAATCCGGGGTGAATACAAATGTTCAGCTTTTCTGTCCGTCTCACAAAGGCCTAACATGAATAGCCTTTTGAGGGATATGCTCTCAAAATTTCAGAGGAGTAGCCGGGACCAAGACAGTGATCAACAAATTGGAGCAAGTAGTGACCAGCAACTCATTGATCACCTAAGAGCATATCTTGAGGATAAACGTCTGAAAGATCCTCAGGATAAAGGGTACCTTGTTGTCATAGATGATATTTGGAGTACCACGGCATGGAAAACAATACAGTGTGCTCTTCCCACAACTATCCATGCAAGCAGGATAATAATAACAACACGCATCAACAACATAGCTGAATCTTGTTGCACTCCATGTAAAGGCTTTGTTTATAAAATGGAACCCCTTAGCAGACAGAACTCTGAAATTTTGTTCGTGAAAAGGATATTTGGTGCCAACAGTACATGCCCAAGTCAGCTGAAGGAGATCATGAATGAGATACTAGATAAATGTGATGGTTTGCCACTGGCCATTGTCACATTAGCAAGCATGTTGGCTAATAATCGAAGGAAGGAAGAATGGGAAAGAGTGTTGAAGTCTATAGGTTCCACAAATGAGAAATATGGAGAGTGGGATACCATACATAAGATATTATCCCTGAGTTACAATGACTTGCCTCTCTATTTACGCCCTTGCTTATTGTACCTTACTACATTTCCAGAAGATTATGAGATTGATAAAAGCCGCTTGATATGGAGTTGGATATGTGAAGGATTCATAACAACAAAACAACAATATTCTTTGGATGAAGTAGGTGAGAGTTACTTCAATGATCTCATTAATAGGAGTTTGATTATACCAATCAAAATAGAATCTGATGGTGAAGCCAGAGGATGTCGAGTTCATGATATAGTTCTCGACTTCATTCTCTCCCGATCAATTGAAGAAAATTTTGTAACTGTACTTGATGGTCAGGAGAACTCATCTCAACTTGGCAAGATTCGCAGGCTCCTTTTCCAAAATAATGATGAACCTGCTGGAGCAATATCACTAGGAACTATGGAGCTATCTCATCTCCGATCACTTAATTCTTTTGGTGTTTCTAGGTTGATGCCCCCTCTTCAGGACCTGCAAGTTCTTCGAGTGTTAGACCTAGAGGACTACCCTGAGGAGAATGGTCAAGGATTATATAATTATCTGGAGAATATTGGATGTCTGTTACATTTGCGATATTTGGCCCTCAGTTGGATAGAGAAGCTTCCAGTCCAGATAGGAAAGTTGGAATTTTTGCAGACACTCGATCTGTTAGGGACTAATATAGAAGAGTTACCAGAAACCCTTATTCAGCTCAAACGGTTGATACGTCTGGTAGGGAATGGACTAAGATTGCCAGGTGGGTTTGGTCAGATGGAAGCTCTGCAAGAGCTATGGGATGTTGATGTTGGCATATGCTCAATAAACTTTGTGGAAGATCTACAAAATTTGAAACAGCTGAGAGCTCTGGGAGTACATTTTTACTGGTTACAGAGTGGTTATTCAAAAATTGGGCTGAGAGCTTTGGCCTCATCCCTCTGTAATATGGGGGAACATAACCTTCGGTATCTACAGATTTCCAATGACACAAAACATGGTGATATAGATTGCCTTGTAGATTCATGGTGCGGTCCTCAACGTTCCCTTGAATGCTTTGTGTTGGGAGGCAGTTACGATTGGTTTCCCAGGCTTCCAAAGTGGTCTAATCCCTCATTTTCAGAGCTTACCAACTTGCAGTGCAATGTTGAGCTAATGGAAAAGGAAGATCTGGATATGCTCGGTGAATTGCCTGCTCTTCTTGTCCTTGAGCTAATTGTAGAAAAAACTCCCAAAGATGGACTTAGGGTGGGTCAAAATGGATTCTCATGTTTAACATGTCTCGTCTTCTATGACATATATGGCCCTGGTTTGATGTTTGAAGAATATGCAATGCCAAAGCTCGAAAAGCTTTACCTTGGATTAAGCGCATATTCCGCATATAATGCATATGGAGGTTTTGGACTTGGAATCCGACACCTCTCCTCTCTCAATCTGTACTCTATTTCCGTTGGAATTGAACGCAAATGTAAATATGTTCCAGAGACGAAGGCTGCTGCAATGTCTATTATCAACAACGAATTCAAGTCGCTTCCTCACCCACCCAAGGTTGAATTCACAATAATCCATGTATATGGGGATCTTGTTGAGGAGTCTGAACTAGAGACCGACTTTTCGATCTTATCTAAAATCATCAAGGCTAGGCTCAGCAGAAGCTCCCAACTACGAGAGGTAATGGGGGACTGA


Protein sequences

Name Description Sequence
hypothetical protein Os11g0237600 [Oryza sativa (japonica cultivar-group)].

MAGVGEKMMVSALTGVMSPVLGKLAGLMEQEYSKLRGVRKKMEQLRKELITINLAVEQYASMDDDPDKLRRAWVKEIRELAYDIEDCIDLFVHRSNHEFSAGGGVRRLLLDSISKLRGLHHRHKFAAQIQQLKNTAGEIHERNLKYKADGCSSAATPPHTEIDPRLPALYEEAERLVGIERQMEEIITRFLVLESTPTNKCSIISIVGQGGLGKTTLARQVYLRIRGEYKCSAFLSVSQRPNMNSLLRDMLSKFQRSSRDQDSDQQIGASSDQQLIDHLRAYLEDKRLKDPQDKGYLVVIDDIWSTTAWKTIQCALPTTIHASRIIITTRINNIAESCCTPCKGFVYKMEPLSRQNSEILFVKRIFGANSTCPSQLKEIMNEILDKCDGLPLAIVTLASMLANNRRKEEWERVLKSIGSTNEKYGEWDTIHKILSLSYNDLPLYLRPCLLYLTTFPEDYEIDKSRLIWSWICEGFITTKQQYSLDEVGESYFNDLINRSLIIPIKIESDGEARGCRVHDIVLDFILSRSIEENFVTVLDGQENSSQLGKIRRLLFQNNDEPAGAISLGTMELSHLRSLNSFGVSRLMPPLQDLQVLRVLDLEDYPEENGQGLYNYLENIGCLLHLRYLALSWIEKLPVQIGKLEFLQTLDLLGTNIEELPETLIQLKRLIRLVGNGLRLPGGFGQMEALQELWDVDVGICSINFVEDLQNLKQLRALGVHFYWLQSGYSKIGLRALASSLCNMGEHNLRYLQISNDTKHGDIDCLVDSWCGPQRSLECFVLGGSYDWFPRLPKWSNPSFSELTNLQCNVELMEKEDLDMLGELPALLVLELIVEKTPKDGLRVGQNGFSCLTCLVFYDIYGPGLMFEEYAMPKLEKLYLGLSAYSAYNAYGGFGLGIRHLSSLNLYSISVGIERKCKYVPETKAAAMSIINNEFKSLPHPPKVEFTIIHVYGDLVEESELETDFSILSKIIKARLSRSSQLREVMGD

Domains

Domain Start-End Description Sequence

Coil: coil
28-49 coiled-coil

MEQEYSKLRGVRKKMEQLRKEL

HMMPanther: PTHR11017
29-985 FAMILY NOT NAMED,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

EQEYSKLRGVRKKMEQLRKELITINLAVEQYASMDDDPDKLRRAWVKEIRELAYDIEDCIDLFVHRSNHEFSAGGGVRRLLLDSISKLRGLHHRHKFAAQIQQLKNTAGEIHERNLKYKADGCSSAATPPHTEIDPRLPALYEEAERLVGIERQMEEIITRFLVLESTPTNKCSIISIVGQGGLGKTTLARQVYLRIRGEYKCSAFLSVSQRPNMNSLLRDMLSKFQRSSRDQDSDQQIGASSDQQLIDHLRAYLEDKRLKDPQDKGYLVVIDDIWSTTAWKTIQCALPTTIHASRIIITTRINNIAESCCTPCKGFVYKMEPLSRQNSEILFVKRIFGANSTCPSQLKEIMNEILDKCDGLPLAIVTLASMLANNRRKEEWERVLKSIGSTNEKYGEWDTIHKILSLSYNDLPLYLRPCLLYLTTFPEDYEIDKSRLIWSWICEGFITTKQQYSLDEVGESYFNDLINRSLIIPIKIESDGEARGCRVHDIVLDFILSRSIEENFVTVLDGQENSSQLGKIRRLLFQNNDEPAGAISLGTMELSHLRSLNSFGVSRLMPPLQDLQVLRVLDLEDYPEENGQGLYNYLENIGCLLHLRYLALSWIEKLPVQIGKLEFLQTLDLLGTNIEELPETLIQLKRLIRLVGNGLRLPGGFGQMEALQELWDVDVGICSINFVEDLQNLKQLRALGVHFYWLQSGYSKIGLRALASSLCNMGEHNLRYLQISNDTKHGDIDCLVDSWCGPQRSLECFVLGGSYDWFPRLPKWSNPSFSELTNLQCNVELMEKEDLDMLGELPALLVLELIVEKTPKDGLRVGQNGFSCLTCLVFYDIYGPGLMFEEYAMPKLEKLYLGLSAYSAYNAYGGFGLGIRHLSSLNLYSISVGIERKCKYVPETKAAAMSIINNEFKSLPHPPKVEFTIIHVYGDLVEESELETDFSILSKIIKARLSRSSQLREVM

HMMPanther: PTHR11017:SF126
29-985 OS11G0237600 PROTEIN,OS11G0237600 PROTEIN

EQEYSKLRGVRKKMEQLRKELITINLAVEQYASMDDDPDKLRRAWVKEIRELAYDIEDCIDLFVHRSNHEFSAGGGVRRLLLDSISKLRGLHHRHKFAAQIQQLKNTAGEIHERNLKYKADGCSSAATPPHTEIDPRLPALYEEAERLVGIERQMEEIITRFLVLESTPTNKCSIISIVGQGGLGKTTLARQVYLRIRGEYKCSAFLSVSQRPNMNSLLRDMLSKFQRSSRDQDSDQQIGASSDQQLIDHLRAYLEDKRLKDPQDKGYLVVIDDIWSTTAWKTIQCALPTTIHASRIIITTRINNIAESCCTPCKGFVYKMEPLSRQNSEILFVKRIFGANSTCPSQLKEIMNEILDKCDGLPLAIVTLASMLANNRRKEEWERVLKSIGSTNEKYGEWDTIHKILSLSYNDLPLYLRPCLLYLTTFPEDYEIDKSRLIWSWICEGFITTKQQYSLDEVGESYFNDLINRSLIIPIKIESDGEARGCRVHDIVLDFILSRSIEENFVTVLDGQENSSQLGKIRRLLFQNNDEPAGAISLGTMELSHLRSLNSFGVSRLMPPLQDLQVLRVLDLEDYPEENGQGLYNYLENIGCLLHLRYLALSWIEKLPVQIGKLEFLQTLDLLGTNIEELPETLIQLKRLIRLVGNGLRLPGGFGQMEALQELWDVDVGICSINFVEDLQNLKQLRALGVHFYWLQSGYSKIGLRALASSLCNMGEHNLRYLQISNDTKHGDIDCLVDSWCGPQRSLECFVLGGSYDWFPRLPKWSNPSFSELTNLQCNVELMEKEDLDMLGELPALLVLELIVEKTPKDGLRVGQNGFSCLTCLVFYDIYGPGLMFEEYAMPKLEKLYLGLSAYSAYNAYGGFGLGIRHLSSLNLYSISVGIERKCKYVPETKAAAMSIINNEFKSLPHPPKVEFTIIHVYGDLVEESELETDFSILSKIIKARLSRSSQLREVM

superfamily: SSF52540
159-423 P-loop containing nucleoside triphosphate hydrolases

HTEIDPRLPALYEEAERLVGIERQMEEIITRFLVLESTPTNKCSIISIVGQGGLGKTTLARQVYLRIRGEYKCSAFLSVSQRPNMNSLLRDMLSKFQRSSRDQDSDQQIGASSDQQLIDHLRAYLEDKRLKDPQDKGYLVVIDDIWSTTAWKTIQCALPTTIHASRIIITTRINNIAESCCTPCKGFVYKMEPLSRQNSEILFVKRIFGANSTCPSQLKEIMNEILDKCDGLPLAIVTLASMLANNRRKEEWERVLKSIGSTNEK

HMMPfam: PF00931
IPR002182
180-480 NB-ARC,NBS
NB-ARC

ERQMEEIITRFLVLESTPTNKCSIISIVGQGGLGKTTLARQVYLRIRGEYKCSAFLSVSQRPNMNSLLRDMLSKFQRSSRDQDSDQQIGASSDQQLIDHLRAYLEDKRLKDPQDKGYLVVIDDIWSTTAWKTIQCALPTTIHASRIIITTRINNIAESCCTPCKGFVYKMEPLSRQNSEILFVKRIFGANSTCPSQLKEIMNEILDKCDGLPLAIVTLASMLANNRRKEEWERVLKSIGSTNEKYGEWDTIHKILSLSYNDLPLYLRPCLLYLTTFPEDYEIDKSRLIWSWICEGFITTKQ

Gene3D: G3DSA:3.40.50.300
184-330 no description

EEIITRFLVLESTPTNKCSIISIVGQGGLGKTTLARQVYLRIRGEYKCSAFLSVSQRPNMNSLLRDMLSKFQRSSRDQDSDQQIGASSDQQLIDHLRAYLEDKRLKDPQDKGYLVVIDDIWSTTAWKTIQCALPTTIHASRIIITTR

FPrintScan: PR00364
IPR000767
203-218 DISEASERSIST
Disease resistance protein

IISIVGQGGLGKTTLA

Seg: seg
255-266 seg

QRSSRDQDSDQQ

FPrintScan: PR00364
IPR000767
290-304 DISEASERSIST
Disease resistance protein

DPQDKGYLVVIDDIW

Seg: seg
324-334 seg

RIIITTRINNI

FPrintScan: PR00364
IPR000767
387-401 DISEASERSIST
Disease resistance protein

CDGLPLAIVTLASML

Seg: seg
441-452 seg

LPLYLRPCLLYL

superfamily: SSF52047
548-861 RNI-like,LRR

GKIRRLLFQNNDEPAGAISLGTMELSHLRSLNSFGVSRLMPPLQDLQVLRVLDLEDYPEENGQGLYNYLENIGCLLHLRYLALSWIEKLPVQIGKLEFLQTLDLLGTNIEELPETLIQLKRLIRLVGNGLRLPGGFGQMEALQELWDVDVGICSINFVEDLQNLKQLRALGVHFYWLQSGYSKIGLRALASSLCNMGEHNLRYLQISNDTKHGDIDCLVDSWCGPQRSLECFVLGGSYDWFPRLPKWSNPSFSELTNLQCNVELMEKEDLDMLGELPALLVLELIVEKTPKDGLRVGQNGFSCLTCLVFYDIYG

Gene3D: G3DSA:3.80.10.10
586-831 no description

LMPPLQDLQVLRVLDLEDYPEENGQGLYNYLENIGCLLHLRYLALSWIEKLPVQIGKLEFLQTLDLLGTNIEELPETLIQLKRLIRLVGNGLRLPGGFGQMEALQELWDVDVGICSINFVEDLQNLKQLRALGVHFYWLQSGYSKIGLRALASSLCNMGEHNLRYLQISNDTKHGDIDCLVDSWCGPQRSLECFVLGGSYDWFPRLPKWSNPSFSELTNLQCNVELMEKEDLDMLGELPALLVLEL

Seg: seg
588-601 seg

PPLQDLQVLRVLDL

FPrintScan: PR00364
IPR000767
591-607 DISEASERSIST
Disease resistance protein

QDLQVLRVLDLEDYPEE

Seg: seg
820-834 seg

LGELPALLVLELIVE


List of References




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox