PRGDB00049917 (Os11g0229300)

From PRG Wiki
Jump to: navigation, search
Os11g0229300
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 115484822 (NM_001074087)
Gene Class NL
Domain Type LRR, NBS, LRR
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa (japonica cultivar-group) Os11g0229300 (Os11g0229300) mRNA, complete cds.

DNA Sequence

ATGCCAGGAGACCTAAGAAACTGCTTCTTGTATTGCAGCATGTTCCCTGAGGATTACTCCATGTCAAGGGAGAGCCTTGTGCGATTATGGGTTGCAGAAGGCTTTGTAGTGAGAAAAGATGGTAACAAACCAGAGGATGTAGCTGAAGGAAATCTCATGGAACTCATTCACCGTAATATGTTGGAAGTTGTTGAGAATGATGAGCTCAGCAGGGTGAGTACCTGTAAGATGCATGACATTGTGCGCAACCTGGCTCTTGATGTTGCTAAAGAGGAGATGTTTGGCTCAGCAAGTGATAATGGCACAATGACGCAGCTGGATACAGAAGTTCGTCGCTTCTCAACATGTGGATGGAAAGATGATAGCGCACCAAGGGTGTCATTTCCGCACCTCCGAACTCTATTGTCCCTTCAAGCAGTTTCATCCTCCACCAGCATGCTGAACTCAATTTTTTCTGGATCAAACTACCTTAGTGTTCTCGAGCTGCAAGACTCTGAAATCAGTGAAGTGCCGACATCCATAGGTAATCTGTTTAATCTGCGGTACATTGGCTTAAGACGCACCAACGTAAGTAAGCTCCCAGAATGTATTGAGAATCTCTCTAATCTGCAAACTTTAGATATCAAGCAAACCAAAATAGTGAAATTACCACGAGGAATTGTTAAGGTCAAGAAGTTGCGGCACCTTATAGCTGACAGATATGCTGATGAGAAACGGACAGAGTTCCGATACTTCATTGGAGTGGAAGCTCCTAAAGGGTTATCTGGTTTGGAAGAACTACAGACTCTTGAAACTGTTCAAGCCAGCAAGGAATTAGCAGAACAGCTGGAGAAGCTGACGAAACTGCAAAACTTGTGGATTGATAATATCAGTGCTACTAATTGTGCAAAGCTTTTTACTGCTCTGTCCAAGATGCCACTTCTTTCAAGCCTGCTTCTCTCTGCATGTGATGAGAAGGAGGTACTCTGCTTCCAAAATCTCAATCCAATATCCAAGATGTTCCATAGGCTAATTGTCCGAGGGCAGTGGGCCACTGGGACACTGGAATTGCCGATATTTCAGGAACATGGTAAAAATCTCAGGTACCTAGCTCTAAGTTGGTGCCAACTTGGAGAGGATCCACTTCGAGTGCTCGGGCTACATGTTCCAAACCTCACATACCTGAGACTTAACAACATGAATAGTGCAAACAGGTTGATCATTACTGCAGGATCCTTTCCCAAGTTGAAGACAATTGTCTTGAAGCTCATGCCAAATGTCAACCGGCTGAAGATCGCAGATGATGCACTTCCAGTCATTGAAGGTTTATACATCGATTCACTGGCAGGGCTGGAGAGAGTCCCTGTGGGCATTGAAAACCTTTTCTCCCTGAAGAAACTCTGGCTTCTCAATCTGCATCAAGACTTCAAAGCAGACTGGATTCATAGAGAAATGCACCGGAAAATGCAGCATGTTCCAGATCTGCGTGTTTAG


Protein sequences

Name Description Sequence
hypothetical protein Os11g0229300 [Oryza sativa (japonica cultivar-group)].

MPGDLRNCFLYCSMFPEDYSMSRESLVRLWVAEGFVVRKDGNKPEDVAEGNLMELIHRNMLEVVENDELSRVSTCKMHDIVRNLALDVAKEEMFGSASDNGTMTQLDTEVRRFSTCGWKDDSAPRVSFPHLRTLLSLQAVSSSTSMLNSIFSGSNYLSVLELQDSEISEVPTSIGNLFNLRYIGLRRTNVSKLPECIENLSNLQTLDIKQTKIVKLPRGIVKVKKLRHLIADRYADEKRTEFRYFIGVEAPKGLSGLEELQTLETVQASKELAEQLEKLTKLQNLWIDNISATNCAKLFTALSKMPLLSSLLLSACDEKEVLCFQNLNPISKMFHRLIVRGQWATGTLELPIFQEHGKNLRYLALSWCQLGEDPLRVLGLHVPNLTYLRLNNMNSANRLIITAGSFPKLKTIVLKLMPNVNRLKIADDALPVIEGLYIDSLAGLERVPVGIENLFSLKKLWLLNLHQDFKADWIHREMHRKMQHVPDLRV


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF198
1-490 PTHR23155:SF198,OS11G0227200 PROTEIN

MPGDLRNCFLYCSMFPEDYSMSRESLVRLWVAEGFVVRKDGNKPEDVAEGNLMELIHRNMLEVVENDELSRVSTCKMHDIVRNLALDVAKEEMFGSASDNGTMTQLDTEVRRFSTCGWKDDSAPRVSFPHLRTLLSLQAVSSSTSMLNSIFSGSNYLSVLELQDSEISEVPTSIGNLFNLRYIGLRRTNVSKLPECIENLSNLQTLDIKQTKIVKLPRGIVKVKKLRHLIADRYADEKRTEFRYFIGVEAPKGLSGLEELQTLETVQASKELAEQLEKLTKLQNLWIDNISATNCAKLFTALSKMPLLSSLLLSACDEKEVLCFQNLNPISKMFHRLIVRGQWATGTLELPIFQEHGKNLRYLALSWCQLGEDPLRVLGLHVPNLTYLRLNNMNSANRLIITAGSFPKLKTIVLKLMPNVNRLKIADDALPVIEGLYIDSLAGLERVPVGIENLFSLKKLWLLNLHQDFKADWIHREMHRKMQHVPDLRV

HMMPanther: PTHR23155
1-490 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

MPGDLRNCFLYCSMFPEDYSMSRESLVRLWVAEGFVVRKDGNKPEDVAEGNLMELIHRNMLEVVENDELSRVSTCKMHDIVRNLALDVAKEEMFGSASDNGTMTQLDTEVRRFSTCGWKDDSAPRVSFPHLRTLLSLQAVSSSTSMLNSIFSGSNYLSVLELQDSEISEVPTSIGNLFNLRYIGLRRTNVSKLPECIENLSNLQTLDIKQTKIVKLPRGIVKVKKLRHLIADRYADEKRTEFRYFIGVEAPKGLSGLEELQTLETVQASKELAEQLEKLTKLQNLWIDNISATNCAKLFTALSKMPLLSSLLLSACDEKEVLCFQNLNPISKMFHRLIVRGQWATGTLELPIFQEHGKNLRYLALSWCQLGEDPLRVLGLHVPNLTYLRLNNMNSANRLIITAGSFPKLKTIVLKLMPNVNRLKIADDALPVIEGLYIDSLAGLERVPVGIENLFSLKKLWLLNLHQDFKADWIHREMHRKMQHVPDLRV

HMMPfam: PF00931
IPR002182
3-40 NB-ARC,NBS
NB-ARC

GDLRNCFLYCSMFPEDYSMSRESLVRLWVAEGFVVRKD

superfamily: SSF52058
76-464 SSF52058,LRR

KMHDIVRNLALDVAKEEMFGSASDNGTMTQLDTEVRRFSTCGWKDDSAPRVSFPHLRTLLSLQAVSSSTSMLNSIFSGSNYLSVLELQDSEISEVPTSIGNLFNLRYIGLRRTNVSKLPECIENLSNLQTLDIKQTKIVKLPRGIVKVKKLRHLIADRYADEKRTEFRYFIGVEAPKGLSGLEELQTLETVQASKELAEQLEKLTKLQNLWIDNISATNCAKLFTALSKMPLLSSLLLSACDEKEVLCFQNLNPISKMFHRLIVRGQWATGTLELPIFQEHGKNLRYLALSWCQLGEDPLRVLGLHVPNLTYLRLNNMNSANRLIITAGSFPKLKTIVLKLMPNVNRLKIADDALPVIEGLYIDSLAGLERVPVGIENLFSLKKLWLLN

Gene3D: G3DSA:3.80.10.10
128-231 G3DSA:3.80.10.10

FPHLRTLLSLQAVSSSTSMLNSIFSGSNYLSVLELQDSEISEVPTSIGNLFNLRYIGLRRTNVSKLPECIENLSNLQTLDIKQTKIVKLPRGIVKVKKLRHLIA

Gene3D: G3DSA:3.80.10.10
253-463 G3DSA:3.80.10.10

GLSGLEELQTLETVQASKELAEQLEKLTKLQNLWIDNISATNCAKLFTALSKMPLLSSLLLSACDEKEVLCFQNLNPISKMFHRLIVRGQWATGTLELPIFQEHGKNLRYLALSWCQLGEDPLRVLGLHVPNLTYLRLNNMNSANRLIITAGSFPKLKTIVLKLMPNVNRLKIADDALPVIEGLYIDSLAGLERVPVGIENLFSLKKLWLL


List of References




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox