PRGDB00049919 (Os11g0228800)

From PRG Wiki
Jump to: navigation, search
Os11g0228800
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 115484814 (NM_001074083)
Gene Class RLP
Domain Type LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa (japonica cultivar-group) Os11g0228800 (Os11g0228800) mRNA, complete cds.

DNA Sequence

ATGGTAGAGATTGATAAGGATGTTCGTCGTTTGTCATCTTACCGATGGAAAGACGGTACTGCACCCAGACTTAATCTTCCACGCCTTCGAACTCTAGTATCACTTGAAGCAATTTCATCTTCCCCAGACATGTTGTCCTCAATTTTGTATGGATCAAGCTATCTTACTGTTCTTGAGCTTCAAGATTCAGAAATCACTCAAGTGCCAGCAACTATAGGGAATTTATGTAACTTGCGTTATATTGGCTTGCGACGCACCAAGGTGAAATCACTCCCGGGCTCTGTTGAAAAGTTATCAAACCTCCAAACGCTAGACATCAGGCAAACGCATATAGAGAGTCTACCACAAGGAATCACTAAAATAAAAAAGCTAAGGCACTTGTTAGCTGATAGATATGCTGATGAAAAGCACTCAGAGTTCCGGTTTTTCATAGGAATGCAAGCACCTAAAGATATGTCCAACCTTAAAGAACTACAAACTCTTGAGACCATGGAAGCGAGCAAAGACTTGGCCAAGCAGCTGAAGGAACTAATACAACTACAAAGTGTGTGGATTGATGGCATAAGTTCTGTCGATTGTCAAAATATTTTTGATTCACTATCAAAGATGCCGCTTCTTTCTAGTTTGCTTCTTTCTGCAAGGGATCAGAATGAACGACTCTGCTTTGAGGCATTCAAGCCCATCTCCACTCAATTACACAGGTTAATTATCAGAGGGAAATGGGCCACTGGAACAATGGACTGCCCAATATTTCGTACCCATGGCACATGTGTCAAATATTTAGCTCTAAGTTGGTGTGATCTTGGGGATGATCCATTAAGGATGCTTGCATTATTGCACTTGCCAAATCTCACACATCTGAGACTGAGCAACATGCATAATGCAAAAAAGTTGGTTCTATATGCAGAAAACTTTTTCCGCCTGAAGTCCCTTGTTTTGAAGGACATGCCACATGTCAACCAGATAAATATTATAGGTGGCTCTCTGTCATGCATTGAAGCTTTGTACATCTTGGCACTGCCAAACCTGGACAAAGTCCCACTGGGCATTGAATCCATTCTCTCCCTGAAGAAACTATGGCTGCTGGGCTTGCACATGGACTTTAGGAAGCAATGGAACAATAGTGGAATGCACCAGAAGATGCAGCATATTCCAGAGGAGGATTTGGGTCATCAAAAATGGACCATAACATGTAAACATGGTATACTGGAGGACAAGTTAGAGGCTCCACGTGCAACTCCAATGTATGCCGTGCCTTCCGAGTTCTCAAAAACTGTGGAGCCAACAGATCTAAAGCATGAGTTTCTAAAAGAAATTACAAACAATTTCTCCAAGGAACAAATACTTGGTCAAGGAGCATTTGGAACTGTTTACCGGGGGCTACATAAAAATGGAGAAGAGATCGCTGTGAAGGTGCTTCGTGTTGTGCTTGATCCTGAACGTGGCGAGGAGCAATTCCAGAATGAATGGAGCGGACTTAACTGGCTCACGTGTTACAAAATCATTATGGGGACTTGCCGGGGCTTAAAGTATCTACATAACGAATTGAAAGAACCCATGTACCATTTGGACTTGAAACCTGACAACATATTGCTAGATAAGAACATGGTACCGAAAATTTCAGATTTTGGTTTATCCAAGCTCTTTGGTGAGGAAAAGACACGAATCACCCAAACTTTCAGAGGAACATTAGGATACCTGCCACTAGAATACCTACGATCAGGTATAGTCTCAGACAAATTGGACATATTCAGCCTCGGTGTTGTAATGTTGAAGATAATGGCAGGACCTAGTAACTGGTGCAAACATGAGGAGATGCCTCACAACAGATTTATTGATTTAAGCATGTACCGGTTAGGCGGTTACATTTTGAAGCACGGTCGCTACCGGCCGCCGCCGCCTCCTGTCCTGCTTGAGCGCAGACACCGCCGGCCGCTGGCCGCCGACTCCACGCCCTCCCTCTCCCCCCAAGCCCCACTCTGGCCATCTCCTCGGCCAGATCCAGCGCCGCGGAGGTTGGGGACGCCGGATCTGATGCCCAAGGGCGGCAGCGGGAGGCCTCCCCGAGCTTGCGAGGGGGCTGCCGCTGAGGTGGCCACGGTGACGAGCTCAGTAGTGGTAGTGTCGTCTTCGGGGCTTCGGCGACGTTGCTCTCTCACCAACCACAGCCTGCAGCACGGTGCACAGATCGCACTCGCAGCCCGGAAGGAGTCGAGGAGAACATGGCGAGGAAGATCCTATTTTTTCGGAGATGAGAGCGGCGAGCGGGCGTGGCGGCGAGCAGTGGCGGCATTGGGCAGATCCGGCACGGCACGGCTGGCGGCGCATCGTCGAGCGCCACCTCCACTGCCGAGCGGCGGCGGGCGCGACGTCGGCGGATACAGTATGGCACGGCTGCAGGCGTGGAGGCGACGGTTGACGACGTATCCGGCCATGGTAGGGCGTATCCGGCGCGATGACGGATCCGGGGATAATCCTGTACGGGAAGGCGCGGTGTCGGCGGATCCAACATGGCATGGCGAGGCGAGGGGGCGGCGCATCCGGCCGCCGCTCCGCGCCCCACGTACATGGATCCGGCTGCGGTGGCGGCTCGACGGCGGATCCCGTGACGGGGCGACCGCGGGCGACAGCCGAGGCGGCGGCGGATCGGGCCACCGCTCCGCGCCCCACGCACATGGCGGCGACCACCGCGGCGGCGAGTTCGAACACCGAAGGACATGGAGGAGCAACGGCGAACACCTCCATGATGCTTCGCCGTTGATGTCCGGAGCAAGTGCCGACAAAAATTTAACTTACGCTTATAGATTGTGA


Protein sequences

Name Description Sequence
hypothetical protein Os11g0228800 [Oryza sativa (japonica cultivar-group)].

MVEIDKDVRRLSSYRWKDGTAPRLNLPRLRTLVSLEAISSSPDMLSSILYGSSYLTVLELQDSEITQVPATIGNLCNLRYIGLRRTKVKSLPGSVEKLSNLQTLDIRQTHIESLPQGITKIKKLRHLLADRYADEKHSEFRFFIGMQAPKDMSNLKELQTLETMEASKDLAKQLKELIQLQSVWIDGISSVDCQNIFDSLSKMPLLSSLLLSARDQNERLCFEAFKPISTQLHRLIIRGKWATGTMDCPIFRTHGTCVKYLALSWCDLGDDPLRMLALLHLPNLTHLRLSNMHNAKKLVLYAENFFRLKSLVLKDMPHVNQINIIGGSLSCIEALYILALPNLDKVPLGIESILSLKKLWLLGLHMDFRKQWNNSGMHQKMQHIPEEDLGHQKWTITCKHGILEDKLEAPRATPMYAVPSEFSKTVEPTDLKHEFLKEITNNFSKEQILGQGAFGTVYRGLHKNGEEIAVKVLRVVLDPERGEEQFQNEWSGLNWLTCYKIIMGTCRGLKYLHNELKEPMYHLDLKPDNILLDKNMVPKISDFGLSKLFGEEKTRITQTFRGTLGYLPLEYLRSGIVSDKLDIFSLGVVMLKIMAGPSNWCKHEEMPHNRFIDLSMYRLGGYILKHGRYRPPPPPVLLERRHRRPLAADSTPSLSPQAPLWPSPRPDPAPRRLGTPDLMPKGGSGRPPRACEGAAAEVATVTSSVVVVSSSGLRRRCSLTNHSLQHGAQIALAARKESRRTWRGRSYFFGDESGERAWRRAVAALGRSGTARLAAHRRAPPPLPSGGGRDVGGYSMARLQAWRRRLTTYPAMVGRIRRDDGSGDNPVREGAVSADPTWHGEARGRRIRPPLRAPRTWIRLRWRLDGGSRDGATAGDSRGGGGSGHRSAPHAHGGDHRGGEFEHRRTWRSNGEHLHDASPLMSGASADKNLTYAYRL

Domains

Domain Start-End Description Sequence

superfamily: SSF52047
26-367 RNI-like,LRR

LPRLRTLVSLEAISSSPDMLSSILYGSSYLTVLELQDSEITQVPATIGNLCNLRYIGLRRTKVKSLPGSVEKLSNLQTLDIRQTHIESLPQGITKIKKLRHLLADRYADEKHSEFRFFIGMQAPKDMSNLKELQTLETMEASKDLAKQLKELIQLQSVWIDGISSVDCQNIFDSLSKMPLLSSLLLSARDQNERLCFEAFKPISTQLHRLIIRGKWATGTMDCPIFRTHGTCVKYLALSWCDLGDDPLRMLALLHLPNLTHLRLSNMHNAKKLVLYAENFFRLKSLVLKDMPHVNQINIIGGSLSCIEALYILALPNLDKVPLGIESILSLKKLWLLGLHMD

Gene3D: G3DSA:3.80.10.10
27-127 no description

PRLRTLVSLEAISSSPDMLSSILYGSSYLTVLELQDSEITQVPATIGNLCNLRYIGLRRTKVKSLPGSVEKLSNLQTLDIRQTHIESLPQGITKIKKLRHL

HMMPanther: PTHR24420
30-618 FAMILY NOT NAMED,FAMILY NOT NAMED

RTLVSLEAISSSPDMLSSILYGSSYLTVLELQDSEITQVPATIGNLCNLRYIGLRRTKVKSLPGSVEKLSNLQTLDIRQTHIESLPQGITKIKKLRHLLADRYADEKHSEFRFFIGMQAPKDMSNLKELQTLETMEASKDLAKQLKELIQLQSVWIDGISSVDCQNIFDSLSKMPLLSSLLLSARDQNERLCFEAFKPISTQLHRLIIRGKWATGTMDCPIFRTHGTCVKYLALSWCDLGDDPLRMLALLHLPNLTHLRLSNMHNAKKLVLYAENFFRLKSLVLKDMPHVNQINIIGGSLSCIEALYILALPNLDKVPLGIESILSLKKLWLLGLHMDFRKQWNNSGMHQKMQHIPEEDLGHQKWTITCKHGILEDKLEAPRATPMYAVPSEFSKTVEPTDLKHEFLKEITNNFSKEQILGQGAFGTVYRGLHKNGEEIAVKVLRVVLDPERGEEQFQNEWSGLNWLTCYKIIMGTCRGLKYLHNELKEPMYHLDLKPDNILLDKNMVPKISDFGLSKLFGEEKTRITQTFRGTLGYLPLEYLRSGIVSDKLDIFSLGVVMLKIMAGPSNWCKHEEMPHNRFIDLSMYR

HMMPanther: PTHR24420:SF757
30-618 OS11G0228800 PROTEIN

RTLVSLEAISSSPDMLSSILYGSSYLTVLELQDSEITQVPATIGNLCNLRYIGLRRTKVKSLPGSVEKLSNLQTLDIRQTHIESLPQGITKIKKLRHLLADRYADEKHSEFRFFIGMQAPKDMSNLKELQTLETMEASKDLAKQLKELIQLQSVWIDGISSVDCQNIFDSLSKMPLLSSLLLSARDQNERLCFEAFKPISTQLHRLIIRGKWATGTMDCPIFRTHGTCVKYLALSWCDLGDDPLRMLALLHLPNLTHLRLSNMHNAKKLVLYAENFFRLKSLVLKDMPHVNQINIIGGSLSCIEALYILALPNLDKVPLGIESILSLKKLWLLGLHMDFRKQWNNSGMHQKMQHIPEEDLGHQKWTITCKHGILEDKLEAPRATPMYAVPSEFSKTVEPTDLKHEFLKEITNNFSKEQILGQGAFGTVYRGLHKNGEEIAVKVLRVVLDPERGEEQFQNEWSGLNWLTCYKIIMGTCRGLKYLHNELKEPMYHLDLKPDNILLDKNMVPKISDFGLSKLFGEEKTRITQTFRGTLGYLPLEYLRSGIVSDKLDIFSLGVVMLKIMAGPSNWCKHEEMPHNRFIDLSMYR

Gene3D: G3DSA:3.80.10.10
152-335 no description

MSNLKELQTLETMEASKDLAKQLKELIQLQSVWIDGISSVDCQNIFDSLSKMPLLSSLLLSARDQNERLCFEAFKPISTQLHRLIIRGKWATGTMDCPIFRTHGTCVKYLALSWCDLGDDPLRMLALLHLPNLTHLRLSNMHNAKKLVLYAENFFRLKSLVLKDMPHVNQINIIGGSLSCIEAL

Seg: seg
199-212 seg

SLSKMPLLSSLLLS

Seg: seg
276-289 seg

LALLHLPNLTHLRL

ProfileScan: PS50011
IPR000719
332-678 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

IEALYILALPNLDKVPLGIESILSLKKLWLLGLHMDFRKQWNNSGMHQKMQHIPEEDLGHQKWTITCKHGILEDKLEAPRATPMYAVPSEFSKTVEPTDLKHEFLKEITNNFSKEQILGQGAFGTVYRGLHKNGEEIAVKVLRVVLDPERGEEQFQNEWSGLNWLTCYKIIMGTCRGLKYLHNELKEPMYHLDLKPDNILLDKNMVPKISDFGLSKLFGEEKTRITQTFRGTLGYLPLEYLRSGIVSDKLDIFSLGVVMLKIMAGPSNWCKHEEMPHNRFIDLSMYRLGGYILKHGRYRPPPPPVLLERRHRRPLAADSTPSLSPQAPLWPSPRPDPAPRRLGTPDL

Seg: seg
354-364 seg

LSLKKLWLLGL

superfamily: SSF56112
IPR011009
415-664 Protein kinase-like (PK-like)
Protein kinase-like domain

MYAVPSEFSKTVEPTDLKHEFLKEITNNFSKEQILGQGAFGTVYRGLHKNGEEIAVKVLRVVLDPERGEEQFQNEWSGLNWLTCYKIIMGTCRGLKYLHNELKEPMYHLDLKPDNILLDKNMVPKISDFGLSKLFGEEKTRITQTFRGTLGYLPLEYLRSGIVSDKLDIFSLGVVMLKIMAGPSNWCKHEEMPHNRFIDLSMYRLGGYILKHGRYRPPPPPVLLERRHRRPLAADSTPSLSPQAPLWPSP

Gene3D: G3DSA:3.30.200.20
424-494 no description

KTVEPTDLKHEFLKEITNNFSKEQILGQGAFGTVYRGLHKNGEEIAVKVLRVVLDPERGEEQFQNEWSGLN

HMMSmart: SM00219
IPR020635
443-654 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSKEQILGQGAFGTVYRGLHKNGEEIAVKVLRVVLDPERGEEQFQNEWSGLNWLTCYKIIMGTCRGLKYLHNELKEPMYHLDLKPDNILLDKNMVPKISDFGLSKLFGEEKTRITQTFRGTLGYLPLEYLRSGIVSDKLDIFSLGVVMLKIMAGPSNWCKHEEMPHNRFIDLSMYRLGGYILKHGRYRPPPPPVLLERRHRRPLAADSTPSL

HMMSmart: SM00220
IPR002290
443-749 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSKEQILGQGAFGTVYRGLHKNGEEIAVKVLRVVLDPERGEEQFQNEWSGLNWLTCYKIIMGTCRGLKYLHNELKEPMYHLDLKPDNILLDKNMVPKISDFGLSKLFGEEKTRITQTFRGTLGYLPLEYLRSGIVSDKLDIFSLGVVMLKIMAGPSNWCKHEEMPHNRFIDLSMYRLGGYILKHGRYRPPPPPVLLERRHRRPLAADSTPSLSPQAPLWPSPRPDPAPRRLGTPDLMPKGGSGRPPRACEGAAAEVATVTSSVVVVSSSGLRRRCSLTNHSLQHGAQIALAARKESRRTWRGRSYFF

PatternScan: PS00107
IPR017441
449-471 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGQGAFGTVYRGLHKNGEEIAVK

HMMPfam: PF00069
IPR000719
493-612 Pkinase,Ser-thr
Protein kinase, catalytic domain

LNWLTCYKIIMGTCRGLKYLHNELKEPMYHLDLKPDNILLDKNMVPKISDFGLSKLFGEEKTRITQTFRGTLGYLPLEYLRSGIVSDKLDIFSLGVVMLKIMAGPSNWCKHEEMPHNRFI

Gene3D: G3DSA:1.10.510.10
495-603 no description

WLTCYKIIMGTCRGLKYLHNELKEPMYHLDLKPDNILLDKNMVPKISDFGLSKLFGEEKTRITQTFRGTLGYLPLEYLRSGIVSDKLDIFSLGVVMLKIMAGPSNWCKH

PatternScan: PS00108
IPR008271
520-532 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

MYHLDLKPDNILL

Seg: seg
628-646 seg

RYRPPPPPVLLERRHRRPL

Seg: seg
689-719 seg

RACEGAAAEVATVTSSVVVVSSSGLRRRCSL

Seg: seg
771-784 seg

ARLAAHRRAPPPLP

Seg: seg
869-894 seg

RDGATAGDSRGGGGSGHRSAPHAHGG


List of References

Hajime Ohyanagi, Tsuyoshi Tanaka, Hiroaki Sakai, Yasumasa Shigemoto, Kaori Yamaguchi, Takuya Habara, Yasuyuki Fujii, Baltazar A Antonio, Yoshiaki Nagamura, Tadashi Imanishi, Kazuho Ikeo, Takeshi Itoh, Takashi Gojobori, Takuji Sasaki
The Rice Annotation Project Database (RAP-DB): hub for Oryza sativa ssp. japonica genome information.
Nucleic Acids Res.: 2006, 34(Database issue);D741-4
PubMed:16381971 WorldCat.org DOI (I p)


The map-based sequence of the rice genome.
Nature: 2005, 436(7052);793-800
PubMed:16100779 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox