PRGDB00049920 (Os11g0228600)

From PRG Wiki
Jump to: navigation, search
Os11g0228600
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 115484812 (NM_001074082)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa (japonica cultivar-group) Os11g0228600 (Os11g0228600) mRNA, partial cds.

DNA Sequence

ATTACTCCATGCAAATGGCGGAAGAATGGTTCCTTAAAAAATACTTCATCAAAGGATCACATCCTTAAAAAATACTTCATCAAAGGATCACATTATGTTTTGGTTTTCACTCAAATTGCTGATGAGGTAGTCAAGATAGAAAAGGAAATCAAACAAGTTATAGAACTCAAGGATCAGTGGTTGCATCCATCCCAGCTTGTTTCTGACCCACTCACTGAGATGGGAAGACAGAGGTCCCGGGACAGCTTCCCAGAACTTGTGAAAGATGAAGATCTTGTGGGGATTGAAGACAGTAGGAGACTGCTGACTGAATGGCTGTACGCTGACGAGCTGGACAGTAAGGTGATAACAGTGTCAGGTATGGGCGGACTGGGGAAAACCACCCTGGTCACAAATGTGTATGAACGTGAAAAGATCAACTTCTCTGCTCATGCATGGATGGTTGTGTCTCAAACCTACACTGTGGATGCTCTATTAAGGAAGCTGCTTAGGAAAGTTGGTTACACAGAACCACCACTGTCATGTAACATTGACAAAATGGATGTGCATGATTTGAAAGAGGAAATAAAGCGAATGCTTAAAGGTAAAAAATGCTTGATCGTACCTGATGATGTCTGGGACCAAGAAGCATACTTTCAAATACGTGATGCATTCCAGAATGACCAAGGAAGTCGCGTAATAATCACAATGCGGAAGAATCATGTGGCAGCTCTTGCTTCCTC


Protein sequences

Name Description Sequence
hypothetical protein Os11g0228600 [Oryza sativa (japonica cultivar-group)].

ITPCKWRKNGSLKNTSSKDHILKKYFIKGSHYVLVFTQIADEVVKIEKEIKQVIELKDQWLHPSQLVSDPLTEMGRQRSRDSFPELVKDEDLVGIEDSRRLLTEWLYADELDSKVITVSGMGGLGKTTLVTNVYEREKINFSAHAWMVVSQTYTVDALLRKLLRKVGYTEPPLSCNIDKMDVHDLKEEIKRMLKGKKCLIVPDDVWDQEAYFQIRDAFQNDQGSRVIITMRKNHVAALASS

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF197
21-231 PTHR23155:SF197,OS11G0227100 PROTEIN

ILKKYFIKGSHYVLVFTQIADEVVKIEKEIKQVIELKDQWLHPSQLVSDPLTEMGRQRSRDSFPELVKDEDLVGIEDSRRLLTEWLYADELDSKVITVSGMGGLGKTTLVTNVYEREKINFSAHAWMVVSQTYTVDALLRKLLRKVGYTEPPLSCNIDKMDVHDLKEEIKRMLKGKKCLIVPDDVWDQEAYFQIRDAFQNDQGSRVIITMR

HMMPanther: PTHR23155
21-231 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

ILKKYFIKGSHYVLVFTQIADEVVKIEKEIKQVIELKDQWLHPSQLVSDPLTEMGRQRSRDSFPELVKDEDLVGIEDSRRLLTEWLYADELDSKVITVSGMGGLGKTTLVTNVYEREKINFSAHAWMVVSQTYTVDALLRKLLRKVGYTEPPLSCNIDKMDVHDLKEEIKRMLKGKKCLIVPDDVWDQEAYFQIRDAFQNDQGSRVIITMR

superfamily: SSF52540
75-236 SSF52540

GRQRSRDSFPELVKDEDLVGIEDSRRLLTEWLYADELDSKVITVSGMGGLGKTTLVTNVYEREKINFSAHAWMVVSQTYTVDALLRKLLRKVGYTEPPLSCNIDKMDVHDLKEEIKRMLKGKKCLIVPDDVWDQEAYFQIRDAFQNDQGSRVIITMRKNHVA

Gene3D: G3DSA:3.40.50.300
98-229 G3DSA:3.40.50.300

SRRLLTEWLYADELDSKVITVSGMGGLGKTTLVTNVYEREKINFSAHAWMVVSQTYTVDALLRKLLRKVGYTEPPLSCNIDKMDVHDLKEEIKRMLKGKKCLIVPDDVWDQEAYFQIRDAFQNDQGSRVIIT

HMMPfam: PF00931
IPR002182
100-239 NB-ARC,NBS
NB-ARC

RLLTEWLYADELDSKVITVSGMGGLGKTTLVTNVYEREKINFSAHAWMVVSQTYTVDALLRKLLRKVGYTEPPLSCNIDKMDVHDLKEEIKRMLKGKKCLIVPDDVWDQEAYFQIRDAFQNDQGSRVIITMRKNHVAALA

FPrintScan: PR00364
IPR000767
115-130 DISEASERSIST
Disease resistance protein

VITVSGMGGLGKTTLV

FPrintScan: PR00364
IPR000767
192-206 DISEASERSIST
Disease resistance protein

MLKGKKCLIVPDDVW


List of References




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox