PRGDB00049922 (Os11g0227100)

From PRG Wiki
Jump to: navigation, search
Os11g0227100
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 115484800 (NM_001074076)
Gene Class NL
Domain Type LRR, NBS, LRR, LRR, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa (japonica cultivar-group) Os11g0227100 (Os11g0227100) mRNA, complete cds.

DNA Sequence

ATGGCAGAGGCAGTACTCCTTGCTCTCACAAAGATCGGTAATGTTTTAGCGGATCAAGTTGCCAAGGACTTGCTTGCCAAACTATCTGAAAAAGTTAATAATCTAAGGGATCTGGATGAGAAGATTGAGCAAATGAGGATGCAACTGGCAACCATGAACAATGTTATATGGAAGATCAGCATGACATGCCTCACCGATGAAGTTGTCAAGGGTTGGATTGGGGAGGTGAGGAAGGTGGCCTACCGTGTTGAGGACGTCATGGACAAATACTCATATTACTCTGTGCAAATGGCGGAAGAATGGTTCCTTAAAAAATACTTCATCAAAGGATCACATTATGTTTTGGTTTTCACTCAAATTGCTGATGAGGTAGTCAAGATAGAGAAGGAAATCAAGCAAGTTGTAGAACTCAAGGATAAGTGGTTGCCGCTATGCCCATTTGTTTCTCACCCACTCACTGAGATGGAGAGACAGAGGTCCCAAGACATCTTCCCGGAACTTGTCAAAGATGAAGATCTTGTGGGTATTGAGGACAATAGGAGACTGCTGACAGAATGGCTATATTATGATGAGTTGGACAATAAGGTGATAACGGTGTCAGGAATGGGTGGACTGGGAAAAACCACCCTGGTCACAAATGTTTATGAGCGTGAAAAGACAAACTTCTCCGCTCATGCATGGATGGCCGTGTCACAAACCTACACAGTCGATGCTCTGTTGAAGAAGTTGCTTAGGAAAGTTGGTTACAAAGGTGAAATTGACAAAATGGATGTTTATGATTTGAAAGAAGAAATAACTCGAGTACTCAAAGATAGGAAATGCTTGATTGTACTGGATGATGTCTGGGACCAAGAAGCATACTTTAAAATATGCGATGCATTCCAGAGCAACCAACAGAGTCGTGTAATCATCACAACACGAAAGAATCATGTTGCAGCTCTTGCTTCCTCAGCATGCCGCCTTGATCTCCAGCCACTGGATGGCAATCAGGCCTTTGATCTATTCTGCAGACGGGCATTTTATAGCACCAAGGACCATGAGTGTCCCAGCGAGCTTGTGGAAGTTGCTGCATCTATAGTAGATCGATGTCAGGGCCTGCCACTGGCGATTGTGTCAATAGGAAGCCTCTTTTTATTCTCAGAGGACTACCCGATCTCCCGTGAGAGCCTTGTGCGACTGTGGATAGCAGAAGGATTTGTCTTGAGCAAAGAGAACAACACACCAGAGGTGGTAGCAGAGGGGAATCTTATGGAACTGATATACCGGAATATGCTTCAAATTAAAGAGAATGATGAGCTAGGCAGGGTGACTACCTGCACAATGCATGATATTGTGCGGGACCTGGCCCTTTCTATTGCTAAAGAGGAGAAATTTGGTTCTGCAAATGATTTCGGCACAATGGTACAGATTAATAAGGATGTTCGTCGTCTATCATCTTATGAATGGAATGATAGTGTTGCTGCCACTGCACCAAAATTTAAACTTCCACGTCTTCGAACACTAGTATCGCTTGGAGCAATTTCATTTCCCACTTATATGTTGGACTCAATTTTGTCAGAATCAAGTTACCTTACTGTTCTTGAGCTCCAAGATTCAGAAATCACTCAATTGCCAAAATCTATAGGCAATATGTTTAATCTGCGTTACATTGGCTTGCGTCGCACAAAGGTCAAGTCACTCCCTGACTCTATTGAAAAGTTGTCTAATCTCTACACTCTGGACATCAAGCAAACCAAAATAGAGAAGCTACCACGTGGAATCACTAAGATCAAGAAGCTAAGGCACCTGCTAGCTGATAGATATGATGATGAGAAACATTCAGAGTTCCGGTACTTCAAAGGCGTGCAAGCACCAAAAGATCTGTCTAACTTGGAAGAACTTCAGACTCTTGAGACCGTGGAAGCTAGCAAGGACTTGGCCGTGCAACTGAAGAAACTGATGCAACTAAGAAGTGTTTGGATTGACAACATAAGTTCTGCTGATTGTGGAAATATTTTTGCTACATTATCAACTATGCCGCTTCTTTCTAGCTTGCTTCTTTCTGCAAGAGATGAGAATGAACCACTTTGCTTTGAGGCTCTCCAGCCCATGTCCAAAGAACTCCACAGGTCAATTATCAGAGGGCAATGGGCCAAGGGCACATTGGACTACCCGATATTTCTTAGCCACACTACACATCTCAAGTACTTAGCTCTAAGTTGGTGTAATCTTGGGGAAGATCCACTGGGGATGCTCGCATCACACTTGTCAAACCTCACTTATCTAAGACTGAACAACATGCACAGTTCGAAAACTTTGGTTCTTGATGCAGAGGCGTTCCCCCACCTGAAGACTCTTGTGTTAATGCACATGCCTGATGTCAACCAGATAAACATCACGGATGGCGCCCTTCCATGCATTGAAGGTTTATACATTGTATCATTGTGGAAGCTGGATAAAGTCCCTCAAGGCATTGAATCCCTTGCCTCCCTGAAGAAGCTCTGGTTGAAGGACCTGCACAAAGACTTCAAGACTCAATGGAAAGGTGACGGGATGCACCAGAAGATGCTGCATGTTGCAGAGATTTATTTCATTGTGGCCAATTTTTTGAGAAGGGTTAACAGTCTGACGGAAAGCAGCGACGACATTTGCCACCGATTAGGTTCTCAGGTTGAGAAGGCACCTGCATTCCAAGAATTGCGGGAAGTTCTTATGAGTAACTATGGCAATCTGTCTGATCATCTTGTCAAGACATGCCTGCTATACATGAGTGTATTCCCAAAGGGTTTTGAGATCAGGAGAAACAGTCTAGCCAGGAGATGGGTAGCTGAAGGATATGCACAGTCTGTGGGTAAATTCACAGACGAAACGGTGGCACATCAAAACTTCAAGAAACTGCTTGACCAGAATATCATCGAGCCGATGGGTGCATGCGACAATGCAAGAGTGAAGACATGCAGAACTAATGCTGTCATGCGCGAGTTCATGCTGCACAGATCCTTCTGTGATCACTTCATCGGGTCTCTTGATACAATGTCAGAGTCAGATGACCCAAGTACCTTTCGTCATCTCTTCATCCAGAATTGCACAAATATCAACATCCTCAGGTTGGCCAAGAAGAAACTTCGTGCCCGTTCTCTGACAATCTTTGGGAGTGGAGGAGGAGGAGCTGTTTCTTGTATGAGAGATGCTCCGGCCTTAGATCTAAAAGAATGCAATGATTTTGATGATAATCGTGTCAAGGGCATCATGAAGGACAATCTCAGTCGTCTAAAATATCTGAGCCTCGGAAGCGCTACTACGAAACTTCCAAAGGCGATTGAGAACCTACAGTGTTTACATACACTCGAATTAAGAAAGACAAATGTAGTGGCACTGCCTATAGAAGTCATAAAGCTGCCCCATCTAGTTCACCTGTTTGGGAAGGTCAAGCTCAGGAAAAAGAGGAGTATTCATGCGGTGCAGGTAATAGATGATATCATCTCAAACAAAAAAAGTATCGGACAAAAGAGTAAGCTGCAGACTCTATCAGGATTTATCATAGACAAAGACTCTATAATTCCGCAACTGATGGTTCATATGAGGGGACTGAGAAAGGTCAAGATATGGTGTGATTATTCCACTGGTGAAGGTAACACTATCCACCTCAAGGAGGCTATTGAAAATATGGTTATGTACGAAATGGACACAGGTGTTGGCGTTCGTTCTCTGTCACTGTACCTCGGAAATGCCTTGGAGAATCTTCTTGGTCTTCTAGGTGAAACAAATGGTTTTCTTACCACTCTGAAACTGCACGGCAGACTGAGCCAATTTCCCAAGTTTGTTACGTCGCTTACAGGCATCAAAGAGTTGTGCCTTTCATCAACTAATCTAACTGGGAGTGATTTATCAGGATCAGGCCTGGGTGATCTACCCTGCTTGCTTTATCTCAAACTGGTAGAATACAACCTTGTGGGCTTCGTCATTAAAAAAGGGGATTACCCAGTCCTGCAGCGCCTATGTCTAGTGGTGGAGAGTCCTAATCCTATCCTACCTAAAATCGAAGAGGAAGCTTTGCCAGAACTTGTTTCACTTCACCTGCTTTGTGTGCGCCTTGGTGATCTTGCTGGCATTAATATTAGAAACCACACAAATCTCCAGGAAGTTGCTCTTGATTCAGCTATCAGTATGGAAACCATAATTACTTGGGAAAATGAAGCTCGGAAGCACCCAAAAAGACCCAAGGTTTTGTTCTTCAAAAGGGTTGGCACACCCAACACTGGGTGTACGATTCTCAGAAGCTGTGGCCTGTTTGGAACAGCTTCTAGTAGAAACAGCTTTTGGGAAAAGCTGCAGCTGGGACAAACTCCCCCAAACAGGGCCTTTGTCTTGGCACCGTCGCTGGTTGCAACTTGCAAGCATGTCGATCGTAAAGCTGTTGTTCCGCAGGAGCTGTAA


Protein sequences

Name Description Sequence
hypothetical protein Os11g0227100 [Oryza sativa (japonica cultivar-group)].

MAEAVLLALTKIGNVLADQVAKDLLAKLSEKVNNLRDLDEKIEQMRMQLATMNNVIWKISMTCLTDEVVKGWIGEVRKVAYRVEDVMDKYSYYSVQMAEEWFLKKYFIKGSHYVLVFTQIADEVVKIEKEIKQVVELKDKWLPLCPFVSHPLTEMERQRSQDIFPELVKDEDLVGIEDNRRLLTEWLYYDELDNKVITVSGMGGLGKTTLVTNVYEREKTNFSAHAWMAVSQTYTVDALLKKLLRKVGYKGEIDKMDVYDLKEEITRVLKDRKCLIVLDDVWDQEAYFKICDAFQSNQQSRVIITTRKNHVAALASSACRLDLQPLDGNQAFDLFCRRAFYSTKDHECPSELVEVAASIVDRCQGLPLAIVSIGSLFLFSEDYPISRESLVRLWIAEGFVLSKENNTPEVVAEGNLMELIYRNMLQIKENDELGRVTTCTMHDIVRDLALSIAKEEKFGSANDFGTMVQINKDVRRLSSYEWNDSVAATAPKFKLPRLRTLVSLGAISFPTYMLDSILSESSYLTVLELQDSEITQLPKSIGNMFNLRYIGLRRTKVKSLPDSIEKLSNLYTLDIKQTKIEKLPRGITKIKKLRHLLADRYDDEKHSEFRYFKGVQAPKDLSNLEELQTLETVEASKDLAVQLKKLMQLRSVWIDNISSADCGNIFATLSTMPLLSSLLLSARDENEPLCFEALQPMSKELHRSIIRGQWAKGTLDYPIFLSHTTHLKYLALSWCNLGEDPLGMLASHLSNLTYLRLNNMHSSKTLVLDAEAFPHLKTLVLMHMPDVNQINITDGALPCIEGLYIVSLWKLDKVPQGIESLASLKKLWLKDLHKDFKTQWKGDGMHQKMLHVAEIYFIVANFLRRVNSLTESSDDICHRLGSQVEKAPAFQELREVLMSNYGNLSDHLVKTCLLYMSVFPKGFEIRRNSLARRWVAEGYAQSVGKFTDETVAHQNFKKLLDQNIIEPMGACDNARVKTCRTNAVMREFMLHRSFCDHFIGSLDTMSESDDPSTFRHLFIQNCTNINILRLAKKKLRARSLTIFGSGGGGAVSCMRDAPALDLKECNDFDDNRVKGIMKDNLSRLKYLSLGSATTKLPKAIENLQCLHTLELRKTNVVALPIEVIKLPHLVHLFGKVKLRKKRSIHAVQVIDDIISNKKSIGQKSKLQTLSGFIIDKDSIIPQLMVHMRGLRKVKIWCDYSTGEGNTIHLKEAIENMVMYEMDTGVGVRSLSLYLGNALENLLGLLGETNGFLTTLKLHGRLSQFPKFVTSLTGIKELCLSSTNLTGSDLSGSGLGDLPCLLYLKLVEYNLVGFVIKKGDYPVLQRLCLVVESPNPILPKIEEEALPELVSLHLLCVRLGDLAGINIRNHTNLQEVALDSAISMETIITWENEARKHPKRPKVLFFKRVGTPNTGCTILRSCGLFGTASSRNSFWEKLQLGQTPPNRAFVLAPSLVATCKHVDRKAVVPQEL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
10-871 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

TKIGNVLADQVAKDLLAKLSEKVNNLRDLDEKIEQMRMQLATMNNVIWKISMTCLTDEVVKGWIGEVRKVAYRVEDVMDKYSYYSVQMAEEWFLKKYFIKGSHYVLVFTQIADEVVKIEKEIKQVVELKDKWLPLCPFVSHPLTEMERQRSQDIFPELVKDEDLVGIEDNRRLLTEWLYYDELDNKVITVSGMGGLGKTTLVTNVYEREKTNFSAHAWMAVSQTYTVDALLKKLLRKVGYKGEIDKMDVYDLKEEITRVLKDRKCLIVLDDVWDQEAYFKICDAFQSNQQSRVIITTRKNHVAALASSACRLDLQPLDGNQAFDLFCRRAFYSTKDHECPSELVEVAASIVDRCQGLPLAIVSIGSLFLFSEDYPISRESLVRLWIAEGFVLSKENNTPEVVAEGNLMELIYRNMLQIKENDELGRVTTCTMHDIVRDLALSIAKEEKFGSANDFGTMVQINKDVRRLSSYEWNDSVAATAPKFKLPRLRTLVSLGAISFPTYMLDSILSESSYLTVLELQDSEITQLPKSIGNMFNLRYIGLRRTKVKSLPDSIEKLSNLYTLDIKQTKIEKLPRGITKIKKLRHLLADRYDDEKHSEFRYFKGVQAPKDLSNLEELQTLETVEASKDLAVQLKKLMQLRSVWIDNISSADCGNIFATLSTMPLLSSLLLSARDENEPLCFEALQPMSKELHRSIIRGQWAKGTLDYPIFLSHTTHLKYLALSWCNLGEDPLGMLASHLSNLTYLRLNNMHSSKTLVLDAEAFPHLKTLVLMHMPDVNQINITDGALPCIEGLYIVSLWKLDKVPQGIESLASLKKLWLKDLHKDFKTQWKGDGMHQKMLHVAEIYFIVANFLRRVNSLTE

HMMPanther: PTHR23155:SF197
10-871 PTHR23155:SF197,OS11G0227100 PROTEIN

TKIGNVLADQVAKDLLAKLSEKVNNLRDLDEKIEQMRMQLATMNNVIWKISMTCLTDEVVKGWIGEVRKVAYRVEDVMDKYSYYSVQMAEEWFLKKYFIKGSHYVLVFTQIADEVVKIEKEIKQVVELKDKWLPLCPFVSHPLTEMERQRSQDIFPELVKDEDLVGIEDNRRLLTEWLYYDELDNKVITVSGMGGLGKTTLVTNVYEREKTNFSAHAWMAVSQTYTVDALLKKLLRKVGYKGEIDKMDVYDLKEEITRVLKDRKCLIVLDDVWDQEAYFKICDAFQSNQQSRVIITTRKNHVAALASSACRLDLQPLDGNQAFDLFCRRAFYSTKDHECPSELVEVAASIVDRCQGLPLAIVSIGSLFLFSEDYPISRESLVRLWIAEGFVLSKENNTPEVVAEGNLMELIYRNMLQIKENDELGRVTTCTMHDIVRDLALSIAKEEKFGSANDFGTMVQINKDVRRLSSYEWNDSVAATAPKFKLPRLRTLVSLGAISFPTYMLDSILSESSYLTVLELQDSEITQLPKSIGNMFNLRYIGLRRTKVKSLPDSIEKLSNLYTLDIKQTKIEKLPRGITKIKKLRHLLADRYDDEKHSEFRYFKGVQAPKDLSNLEELQTLETVEASKDLAVQLKKLMQLRSVWIDNISSADCGNIFATLSTMPLLSSLLLSARDENEPLCFEALQPMSKELHRSIIRGQWAKGTLDYPIFLSHTTHLKYLALSWCNLGEDPLGMLASHLSNLTYLRLNNMHSSKTLVLDAEAFPHLKTLVLMHMPDVNQINITDGALPCIEGLYIVSLWKLDKVPQGIESLASLKKLWLKDLHKDFKTQWKGDGMHQKMLHVAEIYFIVANFLRRVNSLTE

superfamily: SSF52540
156-379 SSF52540

ERQRSQDIFPELVKDEDLVGIEDNRRLLTEWLYYDELDNKVITVSGMGGLGKTTLVTNVYEREKTNFSAHAWMAVSQTYTVDALLKKLLRKVGYKGEIDKMDVYDLKEEITRVLKDRKCLIVLDDVWDQEAYFKICDAFQSNQQSRVIITTRKNHVAALASSACRLDLQPLDGNQAFDLFCRRAFYSTKDHECPSELVEVAASIVDRCQGLPLAIVSIGSLFLF

Gene3D: G3DSA:3.40.50.300
180-307 G3DSA:3.40.50.300

RRLLTEWLYYDELDNKVITVSGMGGLGKTTLVTNVYEREKTNFSAHAWMAVSQTYTVDALLKKLLRKVGYKGEIDKMDVYDLKEEITRVLKDRKCLIVLDDVWDQEAYFKICDAFQSNQQSRVIITTR

HMMPfam: PF00931
IPR002182
181-378 NB-ARC,NBS
NB-ARC

RLLTEWLYYDELDNKVITVSGMGGLGKTTLVTNVYEREKTNFSAHAWMAVSQTYTVDALLKKLLRKVGYKGEIDKMDVYDLKEEITRVLKDRKCLIVLDDVWDQEAYFKICDAFQSNQQSRVIITTRKNHVAALASSACRLDLQPLDGNQAFDLFCRRAFYSTKDHECPSELVEVAASIVDRCQGLPLAIVSIGSLFL

FPrintScan: PR00364
IPR000767
196-211 DISEASERSIST
Disease resistance protein

VITVSGMGGLGKTTLV

FPrintScan: PR00364
IPR000767
268-282 DISEASERSIST
Disease resistance protein

VLKDRKCLIVLDDVW

FPrintScan: PR00364
IPR000767
363-377 DISEASERSIST
Disease resistance protein

CQGLPLAIVSIGSLF

superfamily: SSF52058
440-902 SSF52058,LRR

TMHDIVRDLALSIAKEEKFGSANDFGTMVQINKDVRRLSSYEWNDSVAATAPKFKLPRLRTLVSLGAISFPTYMLDSILSESSYLTVLELQDSEITQLPKSIGNMFNLRYIGLRRTKVKSLPDSIEKLSNLYTLDIKQTKIEKLPRGITKIKKLRHLLADRYDDEKHSEFRYFKGVQAPKDLSNLEELQTLETVEASKDLAVQLKKLMQLRSVWIDNISSADCGNIFATLSTMPLLSSLLLSARDENEPLCFEALQPMSKELHRSIIRGQWAKGTLDYPIFLSHTTHLKYLALSWCNLGEDPLGMLASHLSNLTYLRLNNMHSSKTLVLDAEAFPHLKTLVLMHMPDVNQINITDGALPCIEGLYIVSLWKLDKVPQGIESLASLKKLWLKDLHKDFKTQWKGDGMHQKMLHVAEIYFIVANFLRRVNSLTESSDDICHRLGSQVEKAPAFQELREVLMSNYG

Gene3D: G3DSA:3.80.10.10
490-681 G3DSA:3.80.10.10

APKFKLPRLRTLVSLGAISFPTYMLDSILSESSYLTVLELQDSEITQLPKSIGNMFNLRYIGLRRTKVKSLPDSIEKLSNLYTLDIKQTKIEKLPRGITKIKKLRHLLADRYDDEKHSEFRYFKGVQAPKDLSNLEELQTLETVEASKDLAVQLKKLMQLRSVWIDNISSADCGNIFATLSTMPLLSSLLLS

FPrintScan: PR00364
IPR000767
565-581 DISEASERSIST
Disease resistance protein

EKLSNLYTLDIKQTKIE

Gene3D: G3DSA:3.80.10.10
723-827 G3DSA:3.80.10.10

HTTHLKYLALSWCNLGEDPLGMLASHLSNLTYLRLNNMHSSKTLVLDAEAFPHLKTLVLMHMPDVNQINITDGALPCIEGLYIVSLWKLDKVPQGIESLASLKKL

superfamily: SSF52058
988-1379 SSF52058,LRR

FMLHRSFCDHFIGSLDTMSESDDPSTFRHLFIQNCTNINILRLAKKKLRARSLTIFGSGGGGAVSCMRDAPALDLKECNDFDDNRVKGIMKDNLSRLKYLSLGSATTKLPKAIENLQCLHTLELRKTNVVALPIEVIKLPHLVHLFGKVKLRKKRSIHAVQVIDDIISNKKSIGQKSKLQTLSGFIIDKDSIIPQLMVHMRGLRKVKIWCDYSTGEGNTIHLKEAIENMVMYEMDTGVGVRSLSLYLGNALENLLGLLGETNGFLTTLKLHGRLSQFPKFVTSLTGIKELCLSSTNLTGSDLSGSGLGDLPCLLYLKLVEYNLVGFVIKKGDYPVLQRLCLVVESPNPILPKIEEEALPELVSLHLLCVRLGDLAGINIRNHTNLQEVALDS

Gene3D: G3DSA:3.80.10.10
1067-1116 G3DSA:3.80.10.10

DFDDNRVKGIMKDNLSRLKYLSLGSATTKLPKAIENLQCLHTLELRKTNV

Gene3D: G3DSA:3.80.10.10
1262-1378 G3DSA:3.80.10.10

SQFPKFVTSLTGIKELCLSSTNLTGSDLSGSGLGDLPCLLYLKLVEYNLVGFVIKKGDYPVLQRLCLVVESPNPILPKIEEEALPELVSLHLLCVRLGDLAGINIRNHTNLQEVALD


List of References




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox