PRGDB00049925 (Os11g0225300)

From PRG Wiki
Jump to: navigation, search
Os11g0225300
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 115484786 (NM_001074069)
Gene Class NL
Domain Type LRR, NBS, LRR, LRR, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa (japonica cultivar-group) Os11g0225300 (Os11g0225300) mRNA, complete cds.

DNA Sequence

ATGGATGCTCCGGTGAGTTTCTCCCTAGGTGCCATGGGCCCTCTCCTCAGGAAGCTCGATTCGCTTCCGGTGGCTCCCGAAATCCGGCTGCCTGAGCCACTGAAGGACGGAATCGAGCTCCTCAAGGAAGATCTAGAAGAAATCGGTGCCGCCCTCGTGGAGCAGTCCATGGTAGATTCCCCAAGCCACAGGGCAAGATACTGGATGGATGAGGTGCGTGACCTCTCCTACCACATCGAGGACTGCATCGACACCATGTTTTCGATGCGCTGCGGCGGCGACGACGGCAAGCCCAGATCCGTTCGCCGCCACAAGGTTGGCCGTGTGAAGGTTGACGGTTTCTCCAAGACGCAGAAGCCGTGCACGAGGCTCGCCAGGATCGCGGAGCTCAGGGCTCTGGTGCGGGAGGCCAGCGAGCGCCACGAAAGGTACCAGCTTGGTGACGGCCGCGCCTCGAGCTCGAGCTCGAGCTCTCACCGCGTGTTCACTGCGCACGGCCAGGTTCCTGCGCCGTGCAGAAATCTGGTTGGCATGGACGAACCGAAGACGAAGCTCACCAATATGCTCACCGACGAAGCAGAGCTGCATATGAAAGTGGTATGCATTCTTGGATCAGCCGGTATTGGTAAGACCACGCTTGCTGAACAAGTATACCGTAAACTTAGATGGCAATTCGATTGCCATGCTTTTGTGCGGGCATCACGAAAACCTGACATGAGGAGGCTTCTTGGGGCCATCCTCTCTCAAGTTCAGCTGCGTATACGGATATCTGATACCAGCACGGTGCAGAGCCTTATTGATAATCTCTGGGAGTATCTACAGAAAAAGAGGTATTTTATTGTAATTGATGAATTATATGAAACAGCAACATGGGATATCATTACCAGTGCTTTTCCAGAGGATAATAATTGCAGTAGGATAATGACTACGGCTGGAATTGAAGGTGTAGCTCTCGAATGCTGCAGTTATCATTCTGTCAATATTTTCAAGATGATACCTCTTGGCCTTGATGATTCTGCAAAATTATTCTTTAATAGAGTTTTTGGATCAGAGCAACAATGTCCTTATGAATTGAATGAAGTTTCATATAGGATTACAGCAAAATGTGGTGGATTGCCACTAGCAGTCATTATTATAGCCGGTCTTTTAGCAAGCCTGCCGTGCAAAACAGAGCTGTGGTACAATATAGATGGATGTTTATGTTCCAGTGTGACTACAGATATTGATTTGGATGAGATACTGAAGGAAATCATAAGTCTTGGCTACGACAATCTTCCACATTATTTGAAGACATGTCTGTTGTATCTTAGTTTATATTCGGAGGGTTTCATAATTTGGACGGCTGACTTACTGAAGCAATGGATATCTGAAGGTTTCATCGCTGTAATAGATGGAGAAGACATAGAGGAAGTCGCTGAGAGCTATTTCTATAACCTTGTTAACAGGGGAATGATCCAAAGTGTGAAAACTAAGTACAATAATCAGGTGTTGTGTACTGTGCACCACACTGTATTTGATCTTATTATTCACAAGTCCAAAGAAGAGAAATTTATCTCCGCAATAGATTACTCTCAAACTATGCCAGGAAATTCTTTAGAGGCTCGTCGATTGTCATTCCACTTTAGCAATACCAGATATGCAACTGAAGTTGCAGGTATTACACTGTCACAAGTTCGTTCGTTTGCCTTTCTTGGACTTCTGAAGTGTATGCCTTCTATTATGGAATTTAAGCTTCTTCGGGTTCTAATTCTTGAATTTTGGGGAGATAACCATGGATGCATGAGTTTTAACGTTGCAAGAATTTGTAGATTGTTTCAGCTTAGATATTTGAAGATCTCAAGCCAAATAATAATAGAATTACCAGCCCAGATCCGGGGGCTAAAATACTTGGAAACACTTGAAATAGATGCAAGAGTAACTGCGATTCCATCTGATATTATTCATCTCCGAAGTTTGTTGCATCTATATTTTCAAGATGGGATCGTTCTACCTGATGGCATTGGCTGCATCAGATCTTTGCGTACACTTAAGTATTTTGATCTTGGAAGTAACTCTGAAGAGAATATACGGAGTCTTGGTCAGCTGACGAACTTACGGGATCTTCATCTCACTTGTTCTGCACCAAAATCTAATCAGCAGGCAAAGAGAAACCTCGTAATTCTAGCCTCTTATACTGGGAAACTCGGTAACCTCAAATCTGTCAAATTTTCTCCTGGTGATTCAGGCATGGATATTTCCTTTTTGTTTTATGGAATTGGTATTTCGGTTGATCGTTCCAGAACAGCGTCCTCTCTTCCTTTCTCTGTTAGGACATTAGAGTTGCCATCCATTTGCATATTTGCTAGACTTCCTGACTGGATTGGTCAACTCCGTAAACTCCACACATTGAATCTTGCTGTTAGAGAACTGATAGAAAATGATATTGATAGTCTTGCAGGACTGCCTGACCTCATTGTTCTCTCAATGCATATCATGAAAGCTCCTATGGAAAGGATTGTCTTCAACAGAAAAGCATTTCCAGTTCTCAAGTATTTCAAGTTTATATGTGGCACACTGCGCATGGCTTTTCAGGCAGGAGCCATGGCCAATCTTCACAGGCTCAAGCTAGGTTTCAATGCCCATAAAGGGGAGAAGTATGACAATATTCTTGTAGGCATTGAGCACCTATTAAACCTCAAGAAGATTGCTGTTCGAATTGGAGGAGCTGCTGAAGCCAAGGAGTCTGACAGGATGGCTGCAGAGGCTGCGTTGAAAGAAGCCATTAGAAAGCATCTAATGTTTCTTGATGATCTCGACATAGCAAGGGTAGAATGTGTTAAGGAAGAGTATAAGTGTATTAAGAAAAAACACAAGATCAAGATTGAAGATTCAATTAGCGAAAAAAATGGGGACTCAAAAAAGCAGCATTCTGTCGAAAAGAAAGCAGTGTGGGGCAAAACTATGAAGAATATTGCTGATAGTGGCGTGTTTCCTGAAGATTATACTATGTCAAGGGAGCAACGGGTCGCAGAAGGCTTCGTAGTGGGCATTGAAAAGTGCAGGGCAGAGGATGCGGCCGAGCGAATAATCAGGAATGTGCCTGTGGACTATGATGGGCTTGGCCAGGTGAGCACATCCAAGATACAGGACCACTTGCCTGAACTTGCTCCTCGTGCTGTGCAAAACGAGAAGTTCGGCTCTTCAAATGATCTTAGCATAATGATACAAATCAACAAGTATGCTCGTCTGCCATCTTATGAGTGGAGGGACACTGATATATCCAAACTGAATTTCCGGCTTCTCCGCGCCCCGATGTTACTTGAAGCTGTAACGGCCCGTTGTCACTTGTTGGACTTAATCCTCATTGGTTCAAACAACATTACTGTTCTTGACCTTGGACGTCCCACAATCACCAAACTGCCGGCATCTATAGAATGTCTACCTAATTTACGGTACTTGAGGTTGCAGGGCACGCAACTGAAGTCGCTGTCGGAGGTTATTGTGAAGATGCCCACCATCAGGGGGTTGGACATCAAGAATACCAAGACAGAGGAGCTACCACAAGGCATTTTGAGGATGAAGAAGTTGAGTCACCTGAGTATGGGGGAGAAGCAGAAAAATATTCAAGTATTCATGGAAAAAATGCAGACTCTGGCTGAGACCGTCCAAGACAGCGATGACTTGTCCGACGAAACAGAGGGAATAGCCGACGACGAAGGCGAGTTCTCTACAAGGGCCAACGCGTCAACACCGAAGGTGGATGAGGACGAGGTGGACCGGAGGGCCAATAACTTCATCGCCAGGTTCAGGAAGCAGATCACGATCAGGAATTCAGGATTCGCCAAAAAGGAGAGCAGCATCGACGAACGACTGTGGATACGAGATCTCGATGAGTGCCAACTCTCCAAGAGAGGTGGACGATTTTAA


Protein sequences

Name Description Sequence
hypothetical protein Os11g0225300 [Oryza sativa (japonica cultivar-group)].

MDAPVSFSLGAMGPLLRKLDSLPVAPEIRLPEPLKDGIELLKEDLEEIGAALVEQSMVDSPSHRARYWMDEVRDLSYHIEDCIDTMFSMRCGGDDGKPRSVRRHKVGRVKVDGFSKTQKPCTRLARIAELRALVREASERHERYQLGDGRASSSSSSSHRVFTAHGQVPAPCRNLVGMDEPKTKLTNMLTDEAELHMKVVCILGSAGIGKTTLAEQVYRKLRWQFDCHAFVRASRKPDMRRLLGAILSQVQLRIRISDTSTVQSLIDNLWEYLQKKRYFIVIDELYETATWDIITSAFPEDNNCSRIMTTAGIEGVALECCSYHSVNIFKMIPLGLDDSAKLFFNRVFGSEQQCPYELNEVSYRITAKCGGLPLAVIIIAGLLASLPCKTELWYNIDGCLCSSVTTDIDLDEILKEIISLGYDNLPHYLKTCLLYLSLYSEGFIIWTADLLKQWISEGFIAVIDGEDIEEVAESYFYNLVNRGMIQSVKTKYNNQVLCTVHHTVFDLIIHKSKEEKFISAIDYSQTMPGNSLEARRLSFHFSNTRYATEVAGITLSQVRSFAFLGLLKCMPSIMEFKLLRVLILEFWGDNHGCMSFNVARICRLFQLRYLKISSQIIIELPAQIRGLKYLETLEIDARVTAIPSDIIHLRSLLHLYFQDGIVLPDGIGCIRSLRTLKYFDLGSNSEENIRSLGQLTNLRDLHLTCSAPKSNQQAKRNLVILASYTGKLGNLKSVKFSPGDSGMDISFLFYGIGISVDRSRTASSLPFSVRTLELPSICIFARLPDWIGQLRKLHTLNLAVRELIENDIDSLAGLPDLIVLSMHIMKAPMERIVFNRKAFPVLKYFKFICGTLRMAFQAGAMANLHRLKLGFNAHKGEKYDNILVGIEHLLNLKKIAVRIGGAAEAKESDRMAAEAALKEAIRKHLMFLDDLDIARVECVKEEYKCIKKKHKIKIEDSISEKNGDSKKQHSVEKKAVWGKTMKNIADSGVFPEDYTMSREQRVAEGFVVGIEKCRAEDAAERIIRNVPVDYDGLGQVSTSKIQDHLPELAPRAVQNEKFGSSNDLSIMIQINKYARLPSYEWRDTDISKLNFRLLRAPMLLEAVTARCHLLDLILIGSNNITVLDLGRPTITKLPASIECLPNLRYLRLQGTQLKSLSEVIVKMPTIRGLDIKNTKTEELPQGILRMKKLSHLSMGEKQKNIQVFMEKMQTLAETVQDSDDLSDETEGIADDEGEFSTRANASTPKVDEDEVDRRANNFIARFRKQITIRNSGFAKKESSIDERLWIRDLDECQLSKRGGRF

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
5-1218 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

VSFSLGAMGPLLRKLDSLPVAPEIRLPEPLKDGIELLKEDLEEIGAALVEQSMVDSPSHRARYWMDEVRDLSYHIEDCIDTMFSMRCGGDDGKPRSVRRHKVGRVKVDGFSKTQKPCTRLARIAELRALVREASERHERYQLGDGRASSSSSSSHRVFTAHGQVPAPCRNLVGMDEPKTKLTNMLTDEAELHMKVVCILGSAGIGKTTLAEQVYRKLRWQFDCHAFVRASRKPDMRRLLGAILSQVQLRIRISDTSTVQSLIDNLWEYLQKKRYFIVIDELYETATWDIITSAFPEDNNCSRIMTTAGIEGVALECCSYHSVNIFKMIPLGLDDSAKLFFNRVFGSEQQCPYELNEVSYRITAKCGGLPLAVIIIAGLLASLPCKTELWYNIDGCLCSSVTTDIDLDEILKEIISLGYDNLPHYLKTCLLYLSLYSEGFIIWTADLLKQWISEGFIAVIDGEDIEEVAESYFYNLVNRGMIQSVKTKYNNQVLCTVHHTVFDLIIHKSKEEKFISAIDYSQTMPGNSLEARRLSFHFSNTRYATEVAGITLSQVRSFAFLGLLKCMPSIMEFKLLRVLILEFWGDNHGCMSFNVARICRLFQLRYLKISSQIIIELPAQIRGLKYLETLEIDARVTAIPSDIIHLRSLLHLYFQDGIVLPDGIGCIRSLRTLKYFDLGSNSEENIRSLGQLTNLRDLHLTCSAPKSNQQAKRNLVILASYTGKLGNLKSVKFSPGDSGMDISFLFYGIGISVDRSRTASSLPFSVRTLELPSICIFARLPDWIGQLRKLHTLNLAVRELIENDIDSLAGLPDLIVLSMHIMKAPMERIVFNRKAFPVLKYFKFICGTLRMAFQAGAMANLHRLKLGFNAHKGEKYDNILVGIEHLLNLKKIAVRIGGAAEAKESDRMAAEAALKEAIRKHLMFLDDLDIARVECVKEEYKCIKKKHKIKIEDSISEKNGDSKKQHSVEKKAVWGKTMKNIADSGVFPEDYTMSREQRVAEGFVVGIEKCRAEDAAERIIRNVPVDYDGLGQVSTSKIQDHLPELAPRAVQNEKFGSSNDLSIMIQINKYARLPSYEWRDTDISKLNFRLLRAPMLLEAVTARCHLLDLILIGSNNITVLDLGRPTITKLPASIECLPNLRYLRLQGTQLKSLSEVIVKMPTIRGLDIKNTKTEELPQGILRMKKLSHLSMGEKQKNIQVFMEKMQTLAETVQDS

HMMPanther: PTHR23155:SF196
5-1218 PTHR23155:SF196,OS11G0225300 PROTEIN

VSFSLGAMGPLLRKLDSLPVAPEIRLPEPLKDGIELLKEDLEEIGAALVEQSMVDSPSHRARYWMDEVRDLSYHIEDCIDTMFSMRCGGDDGKPRSVRRHKVGRVKVDGFSKTQKPCTRLARIAELRALVREASERHERYQLGDGRASSSSSSSHRVFTAHGQVPAPCRNLVGMDEPKTKLTNMLTDEAELHMKVVCILGSAGIGKTTLAEQVYRKLRWQFDCHAFVRASRKPDMRRLLGAILSQVQLRIRISDTSTVQSLIDNLWEYLQKKRYFIVIDELYETATWDIITSAFPEDNNCSRIMTTAGIEGVALECCSYHSVNIFKMIPLGLDDSAKLFFNRVFGSEQQCPYELNEVSYRITAKCGGLPLAVIIIAGLLASLPCKTELWYNIDGCLCSSVTTDIDLDEILKEIISLGYDNLPHYLKTCLLYLSLYSEGFIIWTADLLKQWISEGFIAVIDGEDIEEVAESYFYNLVNRGMIQSVKTKYNNQVLCTVHHTVFDLIIHKSKEEKFISAIDYSQTMPGNSLEARRLSFHFSNTRYATEVAGITLSQVRSFAFLGLLKCMPSIMEFKLLRVLILEFWGDNHGCMSFNVARICRLFQLRYLKISSQIIIELPAQIRGLKYLETLEIDARVTAIPSDIIHLRSLLHLYFQDGIVLPDGIGCIRSLRTLKYFDLGSNSEENIRSLGQLTNLRDLHLTCSAPKSNQQAKRNLVILASYTGKLGNLKSVKFSPGDSGMDISFLFYGIGISVDRSRTASSLPFSVRTLELPSICIFARLPDWIGQLRKLHTLNLAVRELIENDIDSLAGLPDLIVLSMHIMKAPMERIVFNRKAFPVLKYFKFICGTLRMAFQAGAMANLHRLKLGFNAHKGEKYDNILVGIEHLLNLKKIAVRIGGAAEAKESDRMAAEAALKEAIRKHLMFLDDLDIARVECVKEEYKCIKKKHKIKIEDSISEKNGDSKKQHSVEKKAVWGKTMKNIADSGVFPEDYTMSREQRVAEGFVVGIEKCRAEDAAERIIRNVPVDYDGLGQVSTSKIQDHLPELAPRAVQNEKFGSSNDLSIMIQINKYARLPSYEWRDTDISKLNFRLLRAPMLLEAVTARCHLLDLILIGSNNITVLDLGRPTITKLPASIECLPNLRYLRLQGTQLKSLSEVIVKMPTIRGLDIKNTKTEELPQGILRMKKLSHLSMGEKQKNIQVFMEKMQTLAETVQDS

superfamily: SSF52540
157-425 SSF52540

SSHRVFTAHGQVPAPCRNLVGMDEPKTKLTNMLTDEAELHMKVVCILGSAGIGKTTLAEQVYRKLRWQFDCHAFVRASRKPDMRRLLGAILSQVQLRIRISDTSTVQSLIDNLWEYLQKKRYFIVIDELYETATWDIITSAFPEDNNCSRIMTTAGIEGVALECCSYHSVNIFKMIPLGLDDSAKLFFNRVFGSEQQCPYELNEVSYRITAKCGGLPLAVIIIAGLLASLPCKTELWYNIDGCLCSSVTTDIDLDEILKEIISLGYDNL

Gene3D: G3DSA:3.40.50.300
173-310 G3DSA:3.40.50.300

RNLVGMDEPKTKLTNMLTDEAELHMKVVCILGSAGIGKTTLAEQVYRKLRWQFDCHAFVRASRKPDMRRLLGAILSQVQLRIRISDTSTVQSLIDNLWEYLQKKRYFIVIDELYETATWDIITSAFPEDNNCSRIMTT

HMMPfam: PF00931
IPR002182
181-464 NB-ARC,NBS
NB-ARC

PKTKLTNMLTDEAELHMKVVCILGSAGIGKTTLAEQVYRKLRWQFDCHAFVRASRKPDMRRLLGAILSQVQLRIRISDTSTVQSLIDNLWEYLQKKRYFIVIDELYETATWDIITSAFPEDNNCSRIMTTAGIEGVALECCSYHSVNIFKMIPLGLDDSAKLFFNRVFGSEQQCPYELNEVSYRITAKCGGLPLAVIIIAGLLASLPCKTELWYNIDGCLCSSVTTDIDLDEILKEIISLGYDNLPHYLKTCLLYLSLYSEGFIIWTADLLKQWISEGFIAVID

FPrintScan: PR00364
IPR000767
199-214 DISEASERSIST
Disease resistance protein

VVCILGSAGIGKTTLA

FPrintScan: PR00364
IPR000767
272-286 DISEASERSIST
Disease resistance protein

YLQKKRYFIVIDELY

FPrintScan: PR00364
IPR000767
369-383 DISEASERSIST
Disease resistance protein

CGGLPLAVIIIAGLL

superfamily: SSF52058
499-898 SSF52058,LRR

TVHHTVFDLIIHKSKEEKFISAIDYSQTMPGNSLEARRLSFHFSNTRYATEVAGITLSQVRSFAFLGLLKCMPSIMEFKLLRVLILEFWGDNHGCMSFNVARICRLFQLRYLKISSQIIIELPAQIRGLKYLETLEIDARVTAIPSDIIHLRSLLHLYFQDGIVLPDGIGCIRSLRTLKYFDLGSNSEENIRSLGQLTNLRDLHLTCSAPKSNQQAKRNLVILASYTGKLGNLKSVKFSPGDSGMDISFLFYGIGISVDRSRTASSLPFSVRTLELPSICIFARLPDWIGQLRKLHTLNLAVRELIENDIDSLAGLPDLIVLSMHIMKAPMERIVFNRKAFPVLKYFKFICGTLRMAFQAGAMANLHRLKLGFNAHKGEKYDNILVGIEHLLNLKKIAVR

Gene3D: G3DSA:3.80.10.10
601-723 G3DSA:3.80.10.10

ICRLFQLRYLKISSQIIIELPAQIRGLKYLETLEIDARVTAIPSDIIHLRSLLHLYFQDGIVLPDGIGCIRSLRTLKYFDLGSNSEENIRSLGQLTNLRDLHLTCSAPKSNQQAKRNLVILAS

FPrintScan: PR00364
IPR000767
671-687 DISEASERSIST
Disease resistance protein

RSLRTLKYFDLGSNSEE

superfamily: SSF52058
720-1207 SSF52058,LRR

ILASYTGKLGNLKSVKFSPGDSGMDISFLFYGIGISVDRSRTASSLPFSVRTLELPSICIFARLPDWIGQLRKLHTLNLAVRELIENDIDSLAGLPDLIVLSMHIMKAPMERIVFNRKAFPVLKYFKFICGTLRMAFQAGAMANLHRLKLGFNAHKGEKYDNILVGIEHLLNLKKIAVRIGGAAEAKESDRMAAEAALKEAIRKHLMFLDDLDIARVECVKEEYKCIKKKHKIKIEDSISEKNGDSKKQHSVEKKAVWGKTMKNIADSGVFPEDYTMSREQRVAEGFVVGIEKCRAEDAAERIIRNVPVDYDGLGQVSTSKIQDHLPELAPRAVQNEKFGSSNDLSIMIQINKYARLPSYEWRDTDISKLNFRLLRAPMLLEAVTARCHLLDLILIGSNNITVLDLGRPTITKLPASIECLPNLRYLRLQGTQLKSLSEVIVKMPTIRGLDIKNTKTEELPQGILRMKKLSHLSMGEKQKNIQVFMEK

Gene3D: G3DSA:3.80.10.10
769-824 G3DSA:3.80.10.10

VRTLELPSICIFARLPDWIGQLRKLHTLNLAVRELIENDIDSLAGLPDLIVLSMHI

Gene3D: G3DSA:3.80.10.10
1080-1198 G3DSA:3.80.10.10

EWRDTDISKLNFRLLRAPMLLEAVTARCHLLDLILIGSNNITVLDLGRPTITKLPASIECLPNLRYLRLQGTQLKSLSEVIVKMPTIRGLDIKNTKTEELPQGILRMKKLSHLSMGEKQ

HMMPfam: PF05553
IPR008480
1248-1266 DUF761
Protein of unknown function DUF761, plant

EDEVDRRANNFIARFRKQI


List of References




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox