PRGDB00049932 (Os10g0370400)

From PRG Wiki
Jump to: navigation, search
Os10g0370400
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 115481727 (NM_001070992)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa (japonica cultivar-group) Os10g0370400 (Os10g0370400) mRNA, complete cds.

DNA Sequence

ATGGAGACCGCGGTGCTGAGCGCCGTGCTCAGAACGCTGGGGCCGAAGCTCTACGCGTTCCTCCGTGACGGGCACGACCTGTTGCGGCGGGACCTGGAGCGCGACGTCCACTACATCCGGAACGAGCTCGCCATGATCGCCGCCGCGATCGAGGAGCACGACCGCCGCCCGCCGCCCGCCGCAGGCGACGTGCGGAGCGCCTGGATCCGCGGCGTGCGCGACCTGGCCTGCGACATGGAGGACTGCGTCGACCGCTTCGTGCACCGCGCCACCGGCCACGGCCTGGCCTCCATGGGCGCCCGCGCCAAGTTCGCCGCCGTGATCCAGGAGCTCAGGAGGAAATCCGAGGAGCTGTCCCGCCTCAGAGCCAGTTACGCCGCCGCCGCCGGCGAGCCCAGCTGCTGGGTGGCTACAGGATCATCCGCGTTGACCCTGCCGGCGTCGTCGTCTGAGGCGCACACCCTTGCATCTGACATCGTGGGGATGGACGGGCCCCGGGACGAGATTCTTGAGCTGATAGGGGAAACCCAGGGCCAGCTCAAGGTGATCTCCATTGTTGGGTTTGGTGGGTTAGGGAAGACGCTTCTTGCCAGGCAAATCTACGAGAGCGACGCCGTCGCCGCGCAATTCCATCCACGGATTTGGGTTCGTGCCGCGGGGAAGAACGCAGAGGATGTCCTCATGGACATTCTCCAGCAGCTGGGGATGCCGGTACATCACTGCCATGCCAGCAATCTCGTTGTAAATCTCAGAAATTGCCTTGAATCCAAGAGAAAGAATCACATGTTCTTTGTTGTAATTGACGACATGCAGAGGGAATATTGGAACAGCTCTTTCAGAAATGCCTTTCCTTCTGATACGGGACTGAGCAGCATTGTGATCGTAACGACGGCCATCCAGTCCATAGCAAATGCCTGCAGCTCTCGCAACAGCCATGTGTACGTGATGAGAACCCTGAATGAGGAACACTCAAGACAGCTATTCTTGAAAGAAGCATCATGGAAAGATTACCCACCAGGTTCAGAAGCAATCCTGAAGAAATGTGATGGTCTGCCGCTTGCTCTCGTCACAACAGCCCAATTCTTGCAAAGCAGATGTCAGCAGCAGCCTCTGGGATGCGCAAAGCTGTGCGACAACCTGGGTAAGCATCTTGTGACAGAAGACACCTTAGCAAGAATGAAGCGTGTGCTTGTTCACCATTACAGCAGCCTCCCTGGCCATGTCATCAAGGCCTGCTTGCTCTACCTGGGAATTTTCCCCAGTGGTCATCCTGTCAGGAGAAAAACTCTGATAAGGAGATGGTCAGCTGAAGGATTCGTGGGAGCAGACCATCACCGGAGCTCTCTAGATGTCGCCATCGACAGCTTCGAGGAGCTCGTTAACCGGAGCATCATCCAGCCTGTTGATGTGAGCAGCAACACTGAGGTGAAGACCTGCCAAACTCACGGTATGATGCTTGAGTTCATCCTGCACAAATCCATATGTGACAACTTCATCACATTTCTGTACGGTCAGGCTCGCCTGCCTGACAAGATCCGTTGCGTTTCCATACAACAGAACAGTGGTAGTAAGACCAGAGTGGATTCAGACATTGATCTGTCCCTTGTCCGGTCTCTGACGATCTTCGGAAAAGCGCACAAGTCTTTCCTGAATTTCTCCAGGTATAAACTTCTCCGGGTTTTGGATCTCGAAGAGTGTGATGAATTGGAGGACGAGCATCTGAAGAAGATATGCAAGCGGTTGCTTCTCAAGTACCTAAGCCTCGGCCGTGGAATTACAGTGCTTCCAAAGGAGATCGCAAAGCTGAAATTTCTTGAGACGCTCGATTTACGGCGAACGGTGATTAAGTTTCTTCCCATACAAGTGCTCGAGCTGCCATGTCTGATTCATCTGTTTGGAGTGTTCAAGATCCAAGATGCTGACCAGCAAATGAGGAAGCTCAAATCCTTCCTGACGGAGAAAAGCAAGTTGGAGACACTGGCCGGATTTGTCACCGATAGGTGCCAAACATTTCCTCAGCTCATGAAACATATGACCAACTTGGCAAAGGTGAAAATATGGTGCGAGAACACCGCAGATGCCAGCAGCAGCAGCAACTCTGATGTTCACCTGTCAGAGGCCATTCAGGAGTTCATCCAGAGAGGCACAGATGTGAACGATGTCCGATCACTCTCTCTCGATGTCGGCGAATGCTCCCAAGAATTTCTCAACTTCTCTTTAGGAGATTCATGCTACCTAAGCTCCCTGAAGCTGAAAGGAAACAAGATATGCAGGTTGCCACCGTTCGTCACCTCGCTGGCCGTTCTCACTGATCTGTGCCTCTCATCCTCTGATCGCCTCAGCTCTGATGTTCTTGCGGCCCTGAGCAACGTCCGCGCGCTGCGTTACCTGAAGCTGATCGCGCGTCACCTGGACAGGTTCGTGATCGAACGCGGCGATCTGCAGAGCCTGCGACGCCTGCACATCGTGGTGGTGTCCATGACGACGATGAGCAAGCAGCAGCCAGAGATCCAGGAGGGAGCCCTGCCGAATCTGGAGTCGTTCCATCTCCTCTGCAAGGATCTGGATGGCCCCTGCGGCCATGGAGGCATCAGGATCGACTCCCTCGGGCTCGGGTGCCTCAGGGAGATTGTTCTTGACGACGGAGTTCGTGAGACGGCGAAGGAGCAGTGGAAGGACGCGGCGAGGCGGCACCCGAAGCGGCCCAAGGTGGTGTTCGTCGGAGCGGGAGACGTCGTCGATCGGCGGCGGGTGGGTGCTGCTGCTGCTGCCGCGCCTGCAGCAGGAGAGAGCAATTCTGCGATGGCACCGGCGGCGGTGGCTTCGGTGGTGGCCGCCGGCGACGTCAAGAGGCCGGCTAGGGAGGAATCCGATATCTCCGCCGCGCTGGCGAGCCTTCCGGCGAAGATGGCGAGGCTGCTCGGCGCTGCGAGCATCCACCAGAGTAGTGGGACTCAGGGCGAGCTGTCCTGCGGCGGGAACGGAGCATCACAGCGCCATTTCAGCTAG


Protein sequences

Name Description Sequence
hypothetical protein Os10g0370400 [Oryza sativa (japonica cultivar-group)].

METAVLSAVLRTLGPKLYAFLRDGHDLLRRDLERDVHYIRNELAMIAAAIEEHDRRPPPAAGDVRSAWIRGVRDLACDMEDCVDRFVHRATGHGLASMGARAKFAAVIQELRRKSEELSRLRASYAAAAGEPSCWVATGSSALTLPASSSEAHTLASDIVGMDGPRDEILELIGETQGQLKVISIVGFGGLGKTLLARQIYESDAVAAQFHPRIWVRAAGKNAEDVLMDILQQLGMPVHHCHASNLVVNLRNCLESKRKNHMFFVVIDDMQREYWNSSFRNAFPSDTGLSSIVIVTTAIQSIANACSSRNSHVYVMRTLNEEHSRQLFLKEASWKDYPPGSEAILKKCDGLPLALVTTAQFLQSRCQQQPLGCAKLCDNLGKHLVTEDTLARMKRVLVHHYSSLPGHVIKACLLYLGIFPSGHPVRRKTLIRRWSAEGFVGADHHRSSLDVAIDSFEELVNRSIIQPVDVSSNTEVKTCQTHGMMLEFILHKSICDNFITFLYGQARLPDKIRCVSIQQNSGSKTRVDSDIDLSLVRSLTIFGKAHKSFLNFSRYKLLRVLDLEECDELEDEHLKKICKRLLLKYLSLGRGITVLPKEIAKLKFLETLDLRRTVIKFLPIQVLELPCLIHLFGVFKIQDADQQMRKLKSFLTEKSKLETLAGFVTDRCQTFPQLMKHMTNLAKVKIWCENTADASSSSNSDVHLSEAIQEFIQRGTDVNDVRSLSLDVGECSQEFLNFSLGDSCYLSSLKLKGNKICRLPPFVTSLAVLTDLCLSSSDRLSSDVLAALSNVRALRYLKLIARHLDRFVIERGDLQSLRRLHIVVVSMTTMSKQQPEIQEGALPNLESFHLLCKDLDGPCGHGGIRIDSLGLGCLREIVLDDGVRETAKEQWKDAARRHPKRPKVVFVGAGDVVDRRRVGAAAAAAPAAGESNSAMAPAAVASVVAAGDVKRPAREESDISAALASLPAKMARLLGAASIHQSSGTQGELSCGGNGASQRHFS

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF268
6-930 PTHR23155:SF268,SUBFAMILY NOT NAMED

LSAVLRTLGPKLYAFLRDGHDLLRRDLERDVHYIRNELAMIAAAIEEHDRRPPPAAGDVRSAWIRGVRDLACDMEDCVDRFVHRATGHGLASMGARAKFAAVIQELRRKSEELSRLRASYAAAAGEPSCWVATGSSALTLPASSSEAHTLASDIVGMDGPRDEILELIGETQGQLKVISIVGFGGLGKTLLARQIYESDAVAAQFHPRIWVRAAGKNAEDVLMDILQQLGMPVHHCHASNLVVNLRNCLESKRKNHMFFVVIDDMQREYWNSSFRNAFPSDTGLSSIVIVTTAIQSIANACSSRNSHVYVMRTLNEEHSRQLFLKEASWKDYPPGSEAILKKCDGLPLALVTTAQFLQSRCQQQPLGCAKLCDNLGKHLVTEDTLARMKRVLVHHYSSLPGHVIKACLLYLGIFPSGHPVRRKTLIRRWSAEGFVGADHHRSSLDVAIDSFEELVNRSIIQPVDVSSNTEVKTCQTHGMMLEFILHKSICDNFITFLYGQARLPDKIRCVSIQQNSGSKTRVDSDIDLSLVRSLTIFGKAHKSFLNFSRYKLLRVLDLEECDELEDEHLKKICKRLLLKYLSLGRGITVLPKEIAKLKFLETLDLRRTVIKFLPIQVLELPCLIHLFGVFKIQDADQQMRKLKSFLTEKSKLETLAGFVTDRCQTFPQLMKHMTNLAKVKIWCENTADASSSSNSDVHLSEAIQEFIQRGTDVNDVRSLSLDVGECSQEFLNFSLGDSCYLSSLKLKGNKICRLPPFVTSLAVLTDLCLSSSDRLSSDVLAALSNVRALRYLKLIARHLDRFVIERGDLQSLRRLHIVVVSMTTMSKQQPEIQEGALPNLESFHLLCKDLDGPCGHGGIRIDSLGLGCLREIVLDDGVRETAKEQWKDAARRHPKRPKVVFVGAGDVVDRRRVGAAAAAAPAAGE

HMMPanther: PTHR23155
6-930 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LSAVLRTLGPKLYAFLRDGHDLLRRDLERDVHYIRNELAMIAAAIEEHDRRPPPAAGDVRSAWIRGVRDLACDMEDCVDRFVHRATGHGLASMGARAKFAAVIQELRRKSEELSRLRASYAAAAGEPSCWVATGSSALTLPASSSEAHTLASDIVGMDGPRDEILELIGETQGQLKVISIVGFGGLGKTLLARQIYESDAVAAQFHPRIWVRAAGKNAEDVLMDILQQLGMPVHHCHASNLVVNLRNCLESKRKNHMFFVVIDDMQREYWNSSFRNAFPSDTGLSSIVIVTTAIQSIANACSSRNSHVYVMRTLNEEHSRQLFLKEASWKDYPPGSEAILKKCDGLPLALVTTAQFLQSRCQQQPLGCAKLCDNLGKHLVTEDTLARMKRVLVHHYSSLPGHVIKACLLYLGIFPSGHPVRRKTLIRRWSAEGFVGADHHRSSLDVAIDSFEELVNRSIIQPVDVSSNTEVKTCQTHGMMLEFILHKSICDNFITFLYGQARLPDKIRCVSIQQNSGSKTRVDSDIDLSLVRSLTIFGKAHKSFLNFSRYKLLRVLDLEECDELEDEHLKKICKRLLLKYLSLGRGITVLPKEIAKLKFLETLDLRRTVIKFLPIQVLELPCLIHLFGVFKIQDADQQMRKLKSFLTEKSKLETLAGFVTDRCQTFPQLMKHMTNLAKVKIWCENTADASSSSNSDVHLSEAIQEFIQRGTDVNDVRSLSLDVGECSQEFLNFSLGDSCYLSSLKLKGNKICRLPPFVTSLAVLTDLCLSSSDRLSSDVLAALSNVRALRYLKLIARHLDRFVIERGDLQSLRRLHIVVVSMTTMSKQQPEIQEGALPNLESFHLLCKDLDGPCGHGGIRIDSLGLGCLREIVLDDGVRETAKEQWKDAARRHPKRPKVVFVGAGDVVDRRRVGAAAAAAPAAGE

superfamily: SSF52540
142-364 SSF52540

ALTLPASSSEAHTLASDIVGMDGPRDEILELIGETQGQLKVISIVGFGGLGKTLLARQIYESDAVAAQFHPRIWVRAAGKNAEDVLMDILQQLGMPVHHCHASNLVVNLRNCLESKRKNHMFFVVIDDMQREYWNSSFRNAFPSDTGLSSIVIVTTAIQSIANACSSRNSHVYVMRTLNEEHSRQLFLKEASWKDYPPGSEAILKKCDGLPLALVTTAQFLQS

Gene3D: G3DSA:3.40.50.300
163-272 G3DSA:3.40.50.300

DGPRDEILELIGETQGQLKVISIVGFGGLGKTLLARQIYESDAVAAQFHPRIWVRAAGKNAEDVLMDILQQLGMPVHHCHASNLVVNLRNCLESKRKNHMFFVVIDDMQR

HMMPfam: PF00931
IPR002182
168-444 NB-ARC,NBS
NB-ARC

EILELIGETQGQLKVISIVGFGGLGKTLLARQIYESDAVAAQFHPRIWVRAAGKNAEDVLMDILQQLGMPVHHCHASNLVVNLRNCLESKRKNHMFFVVIDDMQREYWNSSFRNAFPSDTGLSSIVIVTTAIQSIANACSSRNSHVYVMRTLNEEHSRQLFLKEASWKDYPPGSEAILKKCDGLPLALVTTAQFLQSRCQQQPLGCAKLCDNLGKHLVTEDTLARMKRVLVHHYSSLPGHVIKACLLYLGIFPSGHPVRRKTLIRRWSAEGFVGADH

FPrintScan: PR00364
IPR000767
182-197 DISEASERSIST
Disease resistance protein

VISIVGFGGLGKTLLA

FPrintScan: PR00364
IPR000767
257-271 DISEASERSIST
Disease resistance protein

KRKNHMFFVVIDDMQ

FPrintScan: PR00364
IPR000767
348-362 DISEASERSIST
Disease resistance protein

CDGLPLALVTTAQFL

superfamily: SSF52058
489-852 SSF52058,LRR

ILHKSICDNFITFLYGQARLPDKIRCVSIQQNSGSKTRVDSDIDLSLVRSLTIFGKAHKSFLNFSRYKLLRVLDLEECDELEDEHLKKICKRLLLKYLSLGRGITVLPKEIAKLKFLETLDLRRTVIKFLPIQVLELPCLIHLFGVFKIQDADQQMRKLKSFLTEKSKLETLAGFVTDRCQTFPQLMKHMTNLAKVKIWCENTADASSSSNSDVHLSEAIQEFIQRGTDVNDVRSLSLDVGECSQEFLNFSLGDSCYLSSLKLKGNKICRLPPFVTSLAVLTDLCLSSSDRLSSDVLAALSNVRALRYLKLIARHLDRFVIERGDLQSLRRLHIVVVSMTTMSKQQPEIQEGALPNLESFHLLC

Gene3D: G3DSA:3.80.10.10
527-661 G3DSA:3.80.10.10

VDSDIDLSLVRSLTIFGKAHKSFLNFSRYKLLRVLDLEECDELEDEHLKKICKRLLLKYLSLGRGITVLPKEIAKLKFLETLDLRRTVIKFLPIQVLELPCLIHLFGVFKIQDADQQMRKLKSFLTEKSKLETLA

FPrintScan: PR00364
IPR000767
553-569 DISEASERSIST
Disease resistance protein

SRYKLLRVLDLEECDEL

Gene3D: G3DSA:3.80.10.10
737-851 G3DSA:3.80.10.10

NFSLGDSCYLSSLKLKGNKICRLPPFVTSLAVLTDLCLSSSDRLSSDVLAALSNVRALRYLKLIARHLDRFVIERGDLQSLRRLHIVVVSMTTMSKQQPEIQEGALPNLESFHLL


List of References




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox