PRGDB00049936 (Os10g0132700)

From PRG Wiki
Jump to: navigation, search
Os10g0132700
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 115481031 (NM_001070644)
Gene Class CNL
Domain Type NBS, LRR, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa (japonica cultivar-group) Os10g0132700 (Os10g0132700) mRNA, partial cds.

DNA Sequence

ATGGATGCCGTGGTGAGTGTCTCACATGGGGCACTGGGGCCGCTACTGGGCAAGCTCAGTACCTTGCTCGCAGACAAGTACGCGTGCTTGAAAGGTGTCCGCCGTGAGATCCATTCCCTAAGATCGGAGCTGAGCAACATGCAAGCGGCGCTCCACAAGTATGCGTCACTCGAGGACCCTGACATCCAGGTGAAGGCCTGGATCACCGAGCTGAGGGAGCTTGCCTATGACATCGAGGACTGCATAGACAAGTTTATGCACCAACTTGGTGCCAACGGTGAGCAGCACCGCACCAGTAATAGCATCGAGGACTTCTTTAGGAAGAGTATACAACGTCTCAAAACTCTTGGCCCGAGGCATAATATTGCTGGCGAGATTGAGGAACTGAAGGCACGAGTTATCTCGGTGAGAGATCAAAAGAACAGCTACAAGCTTGACGATATTTTTTGCAGTAGCTCTAGCAATACCAATGCTTCTGTTGATCCACGGTTGGCTACTCTCTTCGCGGAAGAGAACCATCTTGTCGGTATAGATGGCCCAAGGGTTGAACTTGTCAATTGGTTGGATGCAGAGAGCAGGTTGATAAAGTGTCGCAAGGTATTATCTATTGTGGGGTTTGGAGGTCTTGGGAAGACAACTCTAGCGAATGAGGTATATCGTAGGGTTAAAGTTCATTTTGACTGCCATGCATTTGTGTCAGTGTCACAAAAGCCCGATTTCAAGAATATCTTCAAGGATATAACATACAATATGCCTACGAAAGATGGTTTCCTCAAAGATATTGACACATGGAATGAAAAGAAATTTATTGAAAAGCTAAGAGAACTACTTGTGGATAAGAGGTATCTTGTTATAATTGATGATGTATGGTCTATTTCGGCATGGAAAGCTATCACGGTTGCATTCCCGGATAATGACTGTTCCAGTACAATTATAGTTACTACACGCGTTTCCGATGTTGGATGGTCATGCTGCTTAAATGGCATTGACCGCAATTATCAGATGGAACCTCTAAGTGAAGTTCACTCTGGAAGACTATTTTGCAAGAGAATTTTCAGTACAAATGAGGATGGCTGCCCAGATATTTTACAGGAAGTTTCAACAGATATATTGAAGAAATGTGGCGGTCTTCCATTAGCAATTATTAGCATATCTGGCTTATTAGCAAATAGACCAGTTATCAAGGAAGAGTGGGAGAAAGTGAAAGAATCGATTGGTTTTGCATTGGACAAGAACCAAAATCTAGAAGGAATGAAAATCATACTGTCCCTTAGCTTTAATAACCTTCCAAACTATCTCAAGACTTGTTTGCTATATTTGAGCATATTTCCAGAGGATTGTATTATTGAAAGAAACATGGTAGTATGGCGATGGATAGCTGAAGGCTTTATCTCTGAAGACTGTGGGCAGAAATTGGAAGATGTTGCGGAGAGCTACTTTTATGAGCTCATCAACAAAAGTCTGGTTCAACCTGTGGACATTGGTTTTGATGGTAAGGCTCGTGCATGCCGTGTCCATGATATAATGCTTCAATTTATCTCCTCAAAAGCAACAGAAGAGAATTTTGTTACATTATTAGGTGGCCAAACTAGAAAAACGAATTCGCATCATTATGTTCGGCGATTATCCATTCAGGACACTAATAATCATTTGTCAACTCTGTTAGCAAACAAAAATTTATGCCATGTTCGATCCC


Protein sequences

Name Description Sequence
hypothetical protein Os10g0132700 [Oryza sativa (japonica cultivar-group)].

MDAVVSVSHGALGPLLGKLSTLLADKYACLKGVRREIHSLRSELSNMQAALHKYASLEDPDIQVKAWITELRELAYDIEDCIDKFMHQLGANGEQHRTSNSIEDFFRKSIQRLKTLGPRHNIAGEIEELKARVISVRDQKNSYKLDDIFCSSSSNTNASVDPRLATLFAEENHLVGIDGPRVELVNWLDAESRLIKCRKVLSIVGFGGLGKTTLANEVYRRVKVHFDCHAFVSVSQKPDFKNIFKDITYNMPTKDGFLKDIDTWNEKKFIEKLRELLVDKRYLVIIDDVWSISAWKAITVAFPDNDCSSTIIVTTRVSDVGWSCCLNGIDRNYQMEPLSEVHSGRLFCKRIFSTNEDGCPDILQEVSTDILKKCGGLPLAIISISGLLANRPVIKEEWEKVKESIGFALDKNQNLEGMKIILSLSFNNLPNYLKTCLLYLSIFPEDCIIERNMVVWRWIAEGFISEDCGQKLEDVAESYFYELINKSLVQPVDIGFDGKARACRVHDIMLQFISSKATEENFVTLLGGQTRKTNSHHYVRRLSIQDTNNHLSTLLANKNLCHVRS

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
8-453 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

SHGALGPLLGKLSTLLADKYACLKGVRREIHSLRSELSNMQAALHKYASLEDPDIQVKAWITELRELAYDIEDCIDKFMHQLGANGEQHRTSNSIEDFFRKSIQRLKTLGPRHNIAGEIEELKARVISVRDQKNSYKLDDIFCSSSSNTNASVDPRLATLFAEENHLVGIDGPRVELVNWLDAESRLIKCRKVLSIVGFGGLGKTTLANEVYRRVKVHFDCHAFVSVSQKPDFKNIFKDITYNMPTKDGFLKDIDTWNEKKFIEKLRELLVDKRYLVIIDDVWSISAWKAITVAFPDNDCSSTIIVTTRVSDVGWSCCLNGIDRNYQMEPLSEVHSGRLFCKRIFSTNEDGCPDILQEVSTDILKKCGGLPLAIISISGLLANRPVIKEEWEKVKESIGFALDKNQNLEGMKIILSLSFNNLPNYLKTCLLYLSIFPEDCIIERNM

HMMPanther: PTHR23155:SF189
8-453 OS10G0131000 PROTEIN,OS10G0131000 PROTEIN

SHGALGPLLGKLSTLLADKYACLKGVRREIHSLRSELSNMQAALHKYASLEDPDIQVKAWITELRELAYDIEDCIDKFMHQLGANGEQHRTSNSIEDFFRKSIQRLKTLGPRHNIAGEIEELKARVISVRDQKNSYKLDDIFCSSSSNTNASVDPRLATLFAEENHLVGIDGPRVELVNWLDAESRLIKCRKVLSIVGFGGLGKTTLANEVYRRVKVHFDCHAFVSVSQKPDFKNIFKDITYNMPTKDGFLKDIDTWNEKKFIEKLRELLVDKRYLVIIDDVWSISAWKAITVAFPDNDCSSTIIVTTRVSDVGWSCCLNGIDRNYQMEPLSEVHSGRLFCKRIFSTNEDGCPDILQEVSTDILKKCGGLPLAIISISGLLANRPVIKEEWEKVKESIGFALDKNQNLEGMKIILSLSFNNLPNYLKTCLLYLSIFPEDCIIERNM

Seg: seg
12-23 seg

LGPLLGKLSTLL

Coil: coil
30-51 coiled-coil

LKGVRREIHSLRSELSNMQAAL

Coil: coil
126-147 coiled-coil

IEELKARVISVRDQKNSYKLDD

superfamily: SSF52540
157-405 P-loop containing nucleoside triphosphate hydrolases

NASVDPRLATLFAEENHLVGIDGPRVELVNWLDAESRLIKCRKVLSIVGFGGLGKTTLANEVYRRVKVHFDCHAFVSVSQKPDFKNIFKDITYNMPTKDGFLKDIDTWNEKKFIEKLRELLVDKRYLVIIDDVWSISAWKAITVAFPDNDCSSTIIVTTRVSDVGWSCCLNGIDRNYQMEPLSEVHSGRLFCKRIFSTNEDGCPDILQEVSTDILKKCGGLPLAIISISGLLANRPVIKEEWEKVKESI

HMMPfam: PF00931
IPR002182
184-467 NB-ARC,NBS
NB-ARC

LVNWLDAESRLIKCRKVLSIVGFGGLGKTTLANEVYRRVKVHFDCHAFVSVSQKPDFKNIFKDITYNMPTKDGFLKDIDTWNEKKFIEKLRELLVDKRYLVIIDDVWSISAWKAITVAFPDNDCSSTIIVTTRVSDVGWSCCLNGIDRNYQMEPLSEVHSGRLFCKRIFSTNEDGCPDILQEVSTDILKKCGGLPLAIISISGLLANRPVIKEEWEKVKESIGFALDKNQNLEGMKIILSLSFNNLPNYLKTCLLYLSIFPEDCIIERNMVVWRWIAEGFISED

Gene3D: G3DSA:3.40.50.300
196-292 no description

KCRKVLSIVGFGGLGKTTLANEVYRRVKVHFDCHAFVSVSQKPDFKNIFKDITYNMPTKDGFLKDIDTWNEKKFIEKLRELLVDKRYLVIIDDVWSI

FPrintScan: PR00364
IPR000767
200-215 DISEASERSIST
Disease resistance protein

VLSIVGFGGLGKTTLA

FPrintScan: PR00364
IPR000767
276-290 DISEASERSIST
Disease resistance protein

LLVDKRYLVIIDDVW

FPrintScan: PR00364
IPR000767
374-388 DISEASERSIST
Disease resistance protein

CGGLPLAIISISGLL


List of References




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox