PRGDB00049940 (Os10g0124300)

From PRG Wiki
Jump to: navigation, search
Os10g0124300
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 115480957 (NM_001070607)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa (japonica cultivar-group) Os10g0124300 (Os10g0124300) mRNA, complete cds.

DNA Sequence

ATGGAGGTCACAGCAGGGGCGATGAGAGCTCTCCTCCCCAAGCTTGCTAAGCTGCTCAAGGATGAATACAACCTTGAGAAGCATGTGAGGGAAGGGGTCAAGTCTCTGGAGATAGAGCTCACGATGATGCATGCTGCACTCCGTAAGGTGGCTGAGGTGCCCCTAGACCAGCTAGATGATCAGGTCAAGATCTGGGCATCCAAGGTGAGAGAGATCTCGTACGACATGGAGGATGCCGGTGATGCATTCATGGTACGTGTGGAAGATGACTCCCATAGTGGGCCCAGTACCTTCAAGAACAGAGTCAAGAGGCCTATTAAAAAGATAAGCAAATTGTTCAGAAAGGCAAAGGAGCTCCATCAGATTGCTGATGCCATCAAGGAAGCCCAAGCCCTCGCGCAGCAGATGGCTGGGTTGCGTGAAAGGTACAGCGGACTCGAGCTGCAAAACAGCGGCATGGTTACTAGTACTATTGATCCACGCTTGACAGCATTGTACATCGACGCAACAGATCTTGTTGGTATAGATCACGCTAGGGAGGAACTGATCAAGACATTGACAGAAGGTGAAGATTCATCCAAGCAGCAACTGAAGATTATCTCCATCGTTGGCTTTGGAGGACCGGGCAAGACAACTCTTGCAAGAGCAGTGCATGAGAAAATTGAAGCACAGTTTGATTGTTCGGCTTTTGTTTCTGTCTCTAGGAATCCTGACGTAAGAATGATTTTCAAGAAGATGCTTCATCAATTGGACAAAGTAAAATATGCAAACATCAATGAATCATCAAGGGATGAAATACAGCTCATTGACGAATTGAGAGAATTTCTTCAGGACAAGAGGTACTTTATCATAATCGATGACTTATGGGACGAGAGAGTATGGGACTATATCAAGTGTGCTTTTCCTAAAGACAATCTTGGCAGTAGGTTAATCATCACGACCCGCAATGTCAATGTATCTAAAGCATGCTGCTCTGCCAATAATGATATAATCTATAAAATGAAACCTCTTTCTGAAGATGACTCCAAGAAACTCTTCTATAAAAGAATATTTCCTCATGGGAATGGATGTCCTTGTGAACTAGAGGAAGTATCCAATGAAATTTTGAAAAAATGTGGCGGTGTGCCATTAGCCATAATTACTATAGCAAGCCTTTTGGCTAATAAGGAGTTACAGACAAAGGATCAATGGTTTACTTTGCACAATTCTATTGGACGTGGACTTACAGAAGGCCGTAATGTTGAAGACATGCAGAAAATATTATCTTTCAGCTATTATGATCTACCTTCACATCTGAAGTCTTGTTTATTGTGTCTGAGTGTATTCCCAGAAGATTATGAGATTAGGAGAAACCGGCTGATATGGAGGTGGATAGCAGAAGGTTTTGTGCAACAAACACAAAATGGTGGTAGCTTATTTGAGCAAGGTGAAAATTACTTTAACGAACTCGTAAATAGAAGCATGATCCAACCCATTGATATCGATGCTGAAGGCAGAGCAAAAGCTTGTCGTGTACATGACATGGTGCTTGATCTCATATGCCACATGTCAAGCCAACAAAACTTCATCACTGTGTTCAATGATATTGGGAATATCACATGTTCACGAAACAAGCTTCGACGTTTGATGTGCCTACGTGTTAGCTTTGACACAAGGCTGCCAGACAAGCTAGGCGAAATGACATCGCTAGAAGAGTTGTCGAGTATCTCAACTAGTAAATGTGTAGACATTGTGAAAGAGCTGCGCCAACTGACCAGACTGAGAGTGCTTGCCATCGAATGGGAAGAAGTGGGTGAGAAGCAGGACAAAGCTTTAGTAGAGTGCCTGGGAAGTTTGCACAGGCTGCAGATCCTGAATATCTACGCATTTGGTGGATGTCTGAATCTGATGCAGGAAGGCTGGATGCCCCCTACATGTGGGTTGATCAAGTGCGACCGGGGGATATACAAATCCTTGGAGAACTGGCAGCATAGAGGAGCGTGTAGTGGAGAGATTTGTGGTCAGCACCAACGCCTTCCAACGCGCGACAGAGTGCCATCCATGTTCCCACGAGGAGCCATGCCGAGGGTTAGGTACCTTGAGTTCAGCCTCCGAGCATGGGACAACGACATGGCCATCGGTAATGGTAGCAGTGGTGATCTCGACTTGGCCATGGGACATCTCCCTTCACTGGAGCGTGTGAGCGTTACGCTCTTGGTGCACGAGGTCTGA


Protein sequences

Name Description Sequence
hypothetical protein Os10g0124300 [Oryza sativa (japonica cultivar-group)].

MEVTAGAMRALLPKLAKLLKDEYNLEKHVREGVKSLEIELTMMHAALRKVAEVPLDQLDDQVKIWASKVREISYDMEDAGDAFMVRVEDDSHSGPSTFKNRVKRPIKKISKLFRKAKELHQIADAIKEAQALAQQMAGLRERYSGLELQNSGMVTSTIDPRLTALYIDATDLVGIDHAREELIKTLTEGEDSSKQQLKIISIVGFGGPGKTTLARAVHEKIEAQFDCSAFVSVSRNPDVRMIFKKMLHQLDKVKYANINESSRDEIQLIDELREFLQDKRYFIIIDDLWDERVWDYIKCAFPKDNLGSRLIITTRNVNVSKACCSANNDIIYKMKPLSEDDSKKLFYKRIFPHGNGCPCELEEVSNEILKKCGGVPLAIITIASLLANKELQTKDQWFTLHNSIGRGLTEGRNVEDMQKILSFSYYDLPSHLKSCLLCLSVFPEDYEIRRNRLIWRWIAEGFVQQTQNGGSLFEQGENYFNELVNRSMIQPIDIDAEGRAKACRVHDMVLDLICHMSSQQNFITVFNDIGNITCSRNKLRRLMCLRVSFDTRLPDKLGEMTSLEELSSISTSKCVDIVKELRQLTRLRVLAIEWEEVGEKQDKALVECLGSLHRLQILNIYAFGGCLNLMQEGWMPPTCGLIKCDRGIYKSLENWQHRGACSGEICGQHQRLPTRDRVPSMFPRGAMPRVRYLEFSLRAWDNDMAIGNGSSGDLDLAMGHLPSLERVSVTLLVHEV

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017
25-528 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LEKHVREGVKSLEIELTMMHAALRKVAEVPLDQLDDQVKIWASKVREISYDMEDAGDAFMVRVEDDSHSGPSTFKNRVKRPIKKISKLFRKAKELHQIADAIKEAQALAQQMAGLRERYSGLELQNSGMVTSTIDPRLTALYIDATDLVGIDHAREELIKTLTEGEDSSKQQLKIISIVGFGGPGKTTLARAVHEKIEAQFDCSAFVSVSRNPDVRMIFKKMLHQLDKVKYANINESSRDEIQLIDELREFLQDKRYFIIIDDLWDERVWDYIKCAFPKDNLGSRLIITTRNVNVSKACCSANNDIIYKMKPLSEDDSKKLFYKRIFPHGNGCPCELEEVSNEILKKCGGVPLAIITIASLLANKELQTKDQWFTLHNSIGRGLTEGRNVEDMQKILSFSYYDLPSHLKSCLLCLSVFPEDYEIRRNRLIWRWIAEGFVQQTQNGGSLFEQGENYFNELVNRSMIQPIDIDAEGRAKACRVHDMVLDLICHMSSQQNFITVFND

HMMPanther: PTHR11017:SF126
25-528 PTHR11017:SF126,OS11G0237600 PROTEIN

LEKHVREGVKSLEIELTMMHAALRKVAEVPLDQLDDQVKIWASKVREISYDMEDAGDAFMVRVEDDSHSGPSTFKNRVKRPIKKISKLFRKAKELHQIADAIKEAQALAQQMAGLRERYSGLELQNSGMVTSTIDPRLTALYIDATDLVGIDHAREELIKTLTEGEDSSKQQLKIISIVGFGGPGKTTLARAVHEKIEAQFDCSAFVSVSRNPDVRMIFKKMLHQLDKVKYANINESSRDEIQLIDELREFLQDKRYFIIIDDLWDERVWDYIKCAFPKDNLGSRLIITTRNVNVSKACCSANNDIIYKMKPLSEDDSKKLFYKRIFPHGNGCPCELEEVSNEILKKCGGVPLAIITIASLLANKELQTKDQWFTLHNSIGRGLTEGRNVEDMQKILSFSYYDLPSHLKSCLLCLSVFPEDYEIRRNRLIWRWIAEGFVQQTQNGGSLFEQGENYFNELVNRSMIQPIDIDAEGRAKACRVHDMVLDLICHMSSQQNFITVFND

superfamily: SSF52540
155-396 SSF52540

TSTIDPRLTALYIDATDLVGIDHAREELIKTLTEGEDSSKQQLKIISIVGFGGPGKTTLARAVHEKIEAQFDCSAFVSVSRNPDVRMIFKKMLHQLDKVKYANINESSRDEIQLIDELREFLQDKRYFIIIDDLWDERVWDYIKCAFPKDNLGSRLIITTRNVNVSKACCSANNDIIYKMKPLSEDDSKKLFYKRIFPHGNGCPCELEEVSNEILKKCGGVPLAIITIASLLANKELQTKDQ

Gene3D: G3DSA:3.40.50.300
173-321 G3DSA:3.40.50.300

VGIDHAREELIKTLTEGEDSSKQQLKIISIVGFGGPGKTTLARAVHEKIEAQFDCSAFVSVSRNPDVRMIFKKMLHQLDKVKYANINESSRDEIQLIDELREFLQDKRYFIIIDDLWDERVWDYIKCAFPKDNLGSRLIITTRNVNVSK

HMMPfam: PF00931
IPR002182
180-467 NB-ARC,NBS
NB-ARC

EELIKTLTEGEDSSKQQLKIISIVGFGGPGKTTLARAVHEKIEAQFDCSAFVSVSRNPDVRMIFKKMLHQLDKVKYANINESSRDEIQLIDELREFLQDKRYFIIIDDLWDERVWDYIKCAFPKDNLGSRLIITTRNVNVSKACCSANNDIIYKMKPLSEDDSKKLFYKRIFPHGNGCPCELEEVSNEILKKCGGVPLAIITIASLLANKELQTKDQWFTLHNSIGRGLTEGRNVEDMQKILSFSYYDLPSHLKSCLLCLSVFPEDYEIRRNRLIWRWIAEGFVQQTQ

FPrintScan: PR00364
IPR000767
199-214 DISEASERSIST
Disease resistance protein

IISIVGFGGPGKTTLA

FPrintScan: PR00364
IPR000767
275-289 DISEASERSIST
Disease resistance protein

FLQDKRYFIIIDDLW

FPrintScan: PR00364
IPR000767
372-386 DISEASERSIST
Disease resistance protein

CGGVPLAIITIASLL

Gene3D: G3DSA:3.40.50.300
406-465 G3DSA:3.40.50.300

RGLTEGRNVEDMQKILSFSYYDLPSHLKSCLLCLSVFPEDYEIRRNRLIWRWIAEGFVQQ

superfamily: SSF52047
524-620 SSF52047,LRR

TVFNDIGNITCSRNKLRRLMCLRVSFDTRLPDKLGEMTSLEELSSISTSKCVDIVKELRQLTRLRVLAIEWEEVGEKQDKALVECLGSLHRLQILNI

Gene3D: G3DSA:3.80.10.10
527-622 G3DSA:3.80.10.10

NDIGNITCSRNKLRRLMCLRVSFDTRLPDKLGEMTSLEELSSISTSKCVDIVKELRQLTRLRVLAIEWEEVGEKQDKALVECLGSLHRLQILNIYA


List of References




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox