PRGDB00049946 (Os09g0327800)

From PRG Wiki
Jump to: navigation, search
Os09g0327800
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 115478596 (NM_001069427)
Gene Class CNL
Domain Type LRR, NBS, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa (japonica cultivar-group) Os09g0327800 (Os09g0327800) mRNA, complete cds.

DNA Sequence

ATGGCCACAGCCGGTGCCGCCGTGGACCGGCTTCTACGGCGGCTAGCCGCAGATGCTGGTCGTTTGAAGCTGCCCTCGAGCATAGACGAGGATATGGCGCAGGTACGGCGGACCCTGGCAAGGTTGCAAGATGTGCTGCTAAGCGTGGAGGGGAAATACTTCAAGATGAGCATGGAGGCGCAGGAATGGATGAGGAAGATCAATCAGATTTCCTATGACATCCAAGATCTACTAGATGAATTTGAGGACTGCAGTGAGGCCGGATCTCAAAGGGGCAGTTCCTGGATTGCAAAGGAAATATTGTTGTGTTCCTCAAGTCCTTGTTTCTTTAATAGTAGTAGATTGCAAAGAATAAGGATAATCAAAAGAAAGTTAGATCTGTCAACAGAAGATTCTGTTGTATTGAGTTTAATGCAGCACAGTCCATCCAACCTTAAGCATTGCAATGAGCCAGTAATTTTTGATGGATATAAAATCCTTGGGAGGGACAATGACAGAGAAAATGTAAAGAATTTGCTCTTCCAAAATGATGCTGATAAATTTTCCATCATTCCCATTGTCGGCCTTGCGGGGATAGGGAAAACAGCTCTAGCAAGGTTAATTTTCCAAGACTATGGAGAAGAGTGGAACTTTGATCAACGTATATGGATCTGTATCGACAGGAAATTAGAGCTTAATAAAATTGCCAATGATATAATTTCACAGGTTAACAAAAAAGAAGAAACTATTTCAGAGTTTGTCCTGAATGATCAAATTCATAACAACTTGCAGTTTATGAAGAATCGCCTCCAAGAAGTTCTTTCTGACAAAAGCAGTTTGATAGTCTTGGATGGCTTGATTAGCACAGATAAAAATCAGCTAATTGAATTGAAGGAGATGTTGAGGGGTACAGAGAAGTGCACCAAGATCATTGTGACGACTTCCAGTGAAGTATCTGCAGATCTAATAGGCACTGTTCCATCATACAAGTTGCACCCTTTATCTGACGATGACTGTTGGGGAATATTTTGTCAGAGAGCATTTGATAATGGAGCCGGAAACATGGACCGTGCTGAAATTGGGAGGCAAATTGTGAAAAGGTGCGAAGGCATACCTATGGCAGCGTATTCTCTTGGTTCAATGATGCGTAACAAGGATGATAATGCCTGGTTATGGGCAAGGGATAAGGAAATATGGGAATTGCCAAAAGTATTTGCTAATGGGTTTGAGTTACTTGCACCATTCAGTGAAATATATCACAGTATGCCCTCAGCTTTAAAATCATGCTTCTCTTACTTGTCAATCTTCCCCATAGGATTCGTAATAGATAGAGAGAAGCTGATTCAACAGTGGATAGCACTTGACATGGTTGGTTCAAAGCACGGGGCTTTACCTGCTTATGTGCATGGAGAGATGTTCATTCAGGAACTCTTATCACTATTCTTCCTTGAAATCCAAAAGATACCCTCTGTGGTAAAGCGTCCTAAGATGATCCCGGGCTGCCTTATCGCCATAGCAGTAAGGCGCAAGAGAGAGGCGGCATGGGGGAAGAGCAAAGCAGGTTTGCTAATGATGATTGATGACTATAGCAGTTCACATGCTAAATGCGGAAGATATTCAAACACGCAGCTTCCTGTGCAGAAGCCTGTCTCTGCCACTGGAATCAGTCCTACCAATCGTCGTACATTACTCCAGGTGAATAGCTTGGTGCATGCTTTTGCAAAATATGTTGCTGGTAGTGACATTGTAATTTCTGATGGTAGAGAGCTATCAAGGGGCCCTTCAGCTGAAAAGGTCTCTTCCACTTACGCTGTGCTGATAAATCACACAGGACACTCAACCCTTCAGAAAGATGTTCTCACCGGGGCCAGGGCAATATCATTCAAAAACTGTCTTCTTGCAGATGCATTCTTAAGATTGAATCATCTGCGGATCTTGGATCTTACCTGTTGTTATGATCTAGAATTGCCAGCATCCATTGGCTATTTGAAGCTTCTCAGGTATCTTGCTGGTTTTGGCTTAAGAATTCGTAAATTACCAAACCAGATGAGTAGCTTACAAAACCTTGAGGCTTTGGATTTCTCAGAATCACACCTTGAGGAGCTGCCATCATTCATTGGATCTTATCAGAAGCTAACATATTTGAACCTTCAGAGATGTGAGAAACTTCGGAACTTGCCCAGAACACTTGGGGATCTCAAGAGACTAGAATATCTCAACTTATCATACTGCCCCGGAGTCAGTGAGGATGCTGACTACTTATGCAGTCTCCATGCACTTCGATTCTTAGATCTCTCTGGCTGCTCTGAGCTTCAACAGTTACCTCATTTGTTTGGTAACCTAACAAATTTGGAGGATCTAAACCTGTCAGGTTGCTTTAGGCTCGAGAGACTGCCACTGCCAGATTCTATTACAGGACTAGTAAATTTGCAGTATCTGAAACTTTCACATGTCATCTCTGAGCTGCCTGAGTCGCTAAGCAAGCTGGAAAGGCTCCATACGCTAGACCTTACTGGTTATCGTCTACCGCTATCATCAGGCGTCCCTCCAACATTGGCAGACATTATACGGAAGATGCCTAATCTCAATATTATGTTGAGAGATCGTTATGGTGTTGAAATGTCTTGTTCCTCCATTTCTACTGGTGGAAATGGGAGAGGGCTGCCTCTCAATCTCAAAAATAAAAAAATTGTGGTGTTGCAATTTCAGATTTATGTACACCATAATATTCGATGCTCAACAGATAATGCAAATCTCGTGACGGAGGAAACATCTGATGAGAGAGTTACTCTGCGGAAAATACGAAGCTTACATGACCTAGGCGATCTCCACGATATTCACCATTTAGAAAGTCATGAAAAAATAGAGGAGATGCAAGAACAAGCGCGTCAACTTGTTGCTTCCAGTCGTCTTGATGAGTGGGGTATATTTGCAAGGATAAACTATCTCCCATATACTCGTATCATCAAGGCCTGTATCCGGTTTAAGGCAAGGAGGCATCACCCAACAAAGCTTGAGGGCCACCAAACGTCCATCCAAAGCAAGGGTAAACGGAAGCTTCGTTTCGAAAAAGTAGAGATCATCATCCAGATACATGATGAAAAAGAGAAATGTATGAAGAAGACGATGAAAAAGGCGATGAAAAAGGCGGCTAGTGTCACCGGCGTGCAATCGGTGACGCTGTGTGGCGGCAACAGGAACCTGCTGATGGTGATCGGTGAGGGTGTGGACACCAACAAGCTCCTGAAGAAACTCAGAAACAATGTAGGCGCCGCTGATATCGTGGAGACGATGCCGGCGGAGGCCGAAGAGTTCGAGGCAGCAGCAGCAGTCTCCGGAAGCAAGAACTTCATGAAGATGATGCCGCGGTGGCCGAAGAGCTGGTCGTTTGTGAAACAAGAAAGCTTGGTCGATCAACTTAACTTCCCACGCCACAGTTTAGGCGTGTGCTAA


Protein sequences

Name Description Sequence
hypothetical protein Os09g0327800 [Oryza sativa (japonica cultivar-group)].

MATAGAAVDRLLRRLAADAGRLKLPSSIDEDMAQVRRTLARLQDVLLSVEGKYFKMSMEAQEWMRKINQISYDIQDLLDEFEDCSEAGSQRGSSWIAKEILLCSSSPCFFNSSRLQRIRIIKRKLDLSTEDSVVLSLMQHSPSNLKHCNEPVIFDGYKILGRDNDRENVKNLLFQNDADKFSIIPIVGLAGIGKTALARLIFQDYGEEWNFDQRIWICIDRKLELNKIANDIISQVNKKEETISEFVLNDQIHNNLQFMKNRLQEVLSDKSSLIVLDGLISTDKNQLIELKEMLRGTEKCTKIIVTTSSEVSADLIGTVPSYKLHPLSDDDCWGIFCQRAFDNGAGNMDRAEIGRQIVKRCEGIPMAAYSLGSMMRNKDDNAWLWARDKEIWELPKVFANGFELLAPFSEIYHSMPSALKSCFSYLSIFPIGFVIDREKLIQQWIALDMVGSKHGALPAYVHGEMFIQELLSLFFLEIQKIPSVVKRPKMIPGCLIAIAVRRKREAAWGKSKAGLLMMIDDYSSSHAKCGRYSNTQLPVQKPVSATGISPTNRRTLLQVNSLVHAFAKYVAGSDIVISDGRELSRGPSAEKVSSTYAVLINHTGHSTLQKDVLTGARAISFKNCLLADAFLRLNHLRILDLTCCYDLELPASIGYLKLLRYLAGFGLRIRKLPNQMSSLQNLEALDFSESHLEELPSFIGSYQKLTYLNLQRCEKLRNLPRTLGDLKRLEYLNLSYCPGVSEDADYLCSLHALRFLDLSGCSELQQLPHLFGNLTNLEDLNLSGCFRLERLPLPDSITGLVNLQYLKLSHVISELPESLSKLERLHTLDLTGYRLPLSSGVPPTLADIIRKMPNLNIMLRDRYGVEMSCSSISTGGNGRGLPLNLKNKKIVVLQFQIYVHHNIRCSTDNANLVTEETSDERVTLRKIRSLHDLGDLHDIHHLESHEKIEEMQEQARQLVASSRLDEWGIFARINYLPYTRIIKACIRFKARRHHPTKLEGHQTSIQSKGKRKLRFEKVEIIIQIHDEKEKCMKKTMKKAMKKAASVTGVQSVTLCGGNRNLLMVIGEGVDTNKLLKKLRNNVGAADIVETMPAEAEEFEAAAAVSGSKNFMKMMPRWPKSWSFVKQESLVDQLNFPRHSLGVC

Domains

Domain Start-End Description Sequence

Seg: seg
4-22 seg

AGAAVDRLLRRLAADAGRL

Seg: seg
117-124 seg

RIRIIKRK

superfamily: SSF52540
140-396 P-loop containing nucleoside triphosphate hydrolases

HSPSNLKHCNEPVIFDGYKILGRDNDRENVKNLLFQNDADKFSIIPIVGLAGIGKTALARLIFQDYGEEWNFDQRIWICIDRKLELNKIANDIISQVNKKEETISEFVLNDQIHNNLQFMKNRLQEVLSDKSSLIVLDGLISTDKNQLIELKEMLRGTEKCTKIIVTTSSEVSADLIGTVPSYKLHPLSDDDCWGIFCQRAFDNGAGNMDRAEIGRQIVKRCEGIPMAAYSLGSMMRNKDDNAWLWARDKEIWELPK

Gene3D: G3DSA:3.40.50.300
162-310 no description

RDNDRENVKNLLFQNDADKFSIIPIVGLAGIGKTALARLIFQDYGEEWNFDQRIWICIDRKLELNKIANDIISQVNKKEETISEFVLNDQIHNNLQFMKNRLQEVLSDKSSLIVLDGLISTDKNQLIELKEMLRGTEKCTKIIVTTSSE

HMMPfam: PF00931
IPR002182
163-453 NB-ARC,NBS
NB-ARC

DNDRENVKNLLFQNDADKFSIIPIVGLAGIGKTALARLIFQDYGEEWNFDQRIWICIDRKLELNKIANDIISQVNKKEETISEFVLNDQIHNNLQFMKNRLQEVLSDKSSLIVLDGLISTDKNQLIELKEMLRGTEKCTKIIVTTSSEVSADLIGTVPSYKLHPLSDDDCWGIFCQRAFDNGAGNMDRAEIGRQIVKRCEGIPMAAYSLGSMMRNKDDNAWLWARDKEIWELPKVFANGFELLAPFSEIYHSMPSALKSCFSYLSIFPIGFVIDREKLIQQWIALDMVGSK

FPrintScan: PR00364
IPR000767
183-198 DISEASERSIST
Disease resistance protein

IIPIVGLAGIGKTALA

Coil: coil
249-270 coiled-coil

NDQIHNNLQFMKNRLQEVLSDK

FPrintScan: PR00364
IPR000767
266-280 DISEASERSIST
Disease resistance protein

VLSDKSSLIVLDGLI

FPrintScan: PR00364
IPR000767
361-375 DISEASERSIST
Disease resistance protein

CEGIPMAAYSLGSMM

superfamily: SSF52047
613-866 RNI-like,LRR

LTGARAISFKNCLLADAFLRLNHLRILDLTCCYDLELPASIGYLKLLRYLAGFGLRIRKLPNQMSSLQNLEALDFSESHLEELPSFIGSYQKLTYLNLQRCEKLRNLPRTLGDLKRLEYLNLSYCPGVSEDADYLCSLHALRFLDLSGCSELQQLPHLFGNLTNLEDLNLSGCFRLERLPLPDSITGLVNLQYLKLSHVISELPESLSKLERLHTLDLTGYRLPLSSGVPPTLADIIRKMPNLNIMLRDRYGVE

Gene3D: G3DSA:3.80.10.10
625-752 no description

LLADAFLRLNHLRILDLTCCYDLELPASIGYLKLLRYLAGFGLRIRKLPNQMSSLQNLEALDFSESHLEELPSFIGSYQKLTYLNLQRCEKLRNLPRTLGDLKRLEYLNLSYCPGVSEDADYLCSLHA

FPrintScan: PR00364
IPR000767
748-764 DISEASERSIST
Disease resistance protein

CSLHALRFLDLSGCSEL

HMMPfam: PF13855
753-810 LRR_8,Leucine rich repeat

LRFLDLSGCSELQQLPHLFGNLTNLEDLNLSGCFRLERLPLPDSITGLVNLQYLKLSH

Gene3D: G3DSA:3.80.10.10
753-833 no description

LRFLDLSGCSELQQLPHLFGNLTNLEDLNLSGCFRLERLPLPDSITGLVNLQYLKLSHVISELPESLSKLERLHTLDLTGY

Seg: seg
930-942 seg

LHDLGDLHDIHHL

HMMPanther: PTHR22814:SF51
949-1114 OS09G0327800 PROTEIN,OS09G0327800 PROTEIN

EEMQEQARQLVASSRLDEWGIFARINYLPYTRIIKACIRFKARRHHPTKLEGHQTSIQSKGKRKLRFEKVEIIIQIHDEKEKCMKKTMKKAMKKAASVTGVQSVTLCGGNRNLLMVIGEGVDTNKLLKKLRNNVGAADIVETMPAEAEEFEAAAAVSGSKNFMKMM

HMMPanther: PTHR22814
949-1114 FAMILY NOT NAMED,COPPER TRANSPORT PROTEIN ATOX1-RELATED

EEMQEQARQLVASSRLDEWGIFARINYLPYTRIIKACIRFKARRHHPTKLEGHQTSIQSKGKRKLRFEKVEIIIQIHDEKEKCMKKTMKKAMKKAASVTGVQSVTLCGGNRNLLMVIGEGVDTNKLLKKLRNNVGAADIVETMPAEAEEFEAAAAVSGSKNFMKMM

Seg: seg
1028-1044 seg

KEKCMKKTMKKAMKKAA

Seg: seg
1093-1103 seg

AEAEEFEAAAA


List of References




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox