PRGDB00049947 (Os09g0322800)

From PRG Wiki
Jump to: navigation, search
Os09g0322800
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 115478546 (NM_001069402)
Gene Class NL
Domain Type LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, NBS, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa (japonica cultivar-group) Os09g0322800 (Os09g0322800) mRNA, complete cds.

DNA Sequence

ATGAATAGTTTGTTGAAGCAAGCAGCTTACCCCTTCAACATCCGTAGGAATGTGCAGGATCTCATCACGCATACGGATGATCTGGTCGCCAGGAGACACGACATTGCTCGACAGATCGAGGCTGCTGATCGGGACGGCGGAATGATCCCAACCCATGAAGCACGGCAATGGCTGGACAGAGTGGAGAGTGCCAGGCTCTCTGCAGACACGATCCGTGGACGCTACGAGCAGAGATGCAGAATGTTCGGCGGCTGCTCCCTCAATCTCTGGTCCAACTACAGAATCAGCAAGCGTGCAGCGGAGAGGCTCGCGATTGTGAGATCGTACGAGGTTGTTCCGAGCCCGATCACAATCGATCCCCCCGCACTCGCTGCGGTGAACATCCCGATCGAGTCTGTCCAGATTCATAGCCAGGAGAGTATACTCGAGGAGGCGCTCCGGTGCATCACCGAGGGGCCATCGGCGATAATCGGGATATGCGGTCCGGGTGGAGTCGGCAAAACACACCTCCTAAAGAGAATCAACAACAACTTTGTCGGAGACTCTACCTTTCGTCTCGTCATCTTTGTCACAGCGACAAGAGGGTGTTCGGTGCAGACGATCCAGACTCAGATCATGGAGAGGATCAACTTGAATCGAGACGGTGATTCGGTCACACGGGCCAACAGGATAGTGCGATTTCTCAAGGCGAAAAGCTTCCTCCTATTAGTGGATGACCTCTGGGGAGGAGAGCTGGAGATGGGATCAGTTGGTATCCCATATCCCCTTAAGAACGAAGGCCAACTTAAGCAGAAAGTGGTAATCACAACAAGGTCTCCAACCATATGCGAACTGATGAATGTGACGACACATGTAAAGGTGGAGGTGTTAGAGGACGACGAAGCACGCGAGCTGTTTATGGAATATAATGGTCACAAGGGTCTCTATTCTGATCCCCACATCGGAGATCTTGCCAAAGAACTCGTGAAGGAACTGAAAGGTGTTGCATCACAGTTGATACATTTCGGCAAGGAAATGCGCGGGAGAAAAGATCCGAAGCGGTGGGAAGATGCCATTTTTGTAGTGAAGACATCAGATACTACTCACCTGCAGGATGAGGACCAATTATCTCTGAAAGGAACAATTGTGAGGAATCTCAAGGTGGCAACCGAGAATATGCTTGCGAGGAGCAACGAAGTCCGCCAAAAGATTGAGATTGCAGAGCGAAATGGCAAGACACCAACGAATGGGGTGATCTCGTGGCTACGTAGAGTGGATAGCATCACATCTTCTGCAGAAATAATATGTGGGCAACACCAACTGAACTTAGATGTTAGCCAGAGTGCGGCTGAGAAGCTTCATGAGGTCCAAGAATGCCTTGACAATCAGCCCAGCGATATTGTTGTCGATGTTCTCCAAACCCCTACCGAATACATCCCAATCCAGTCTTTTGAACTGCGAAGCCAAAACATTGTTCTTCAGGATGCTCTCCGGTACATTGCGGATGATTCAGTGGAAATGATTGGAATACGGGGTGCAGCTGGGGTGGGCAAAACACATATTCTAAAGAAGATCAACAACTCATTCCATGAACATTCTGACTTTCAGTTTGTCATTTTTGTCACGGCCTCAAGAAACATCAGGGAACAGATTGCAAGGAGGCTGGGGATAAACCAAGACGACCGTGACGCAAAACTTGTTACCAGGATTTCGAAATTCCTTGAGAAAAGAAGTTTCCTTCTGTTGGTGGATGACCTCAGGGAGATTCTTGACCCAAAAGAAGCAGGCATCCCATTTCCCCTTAGAAACTCAAGTGAAATTAGACAGAAAGTGGTATTTACTACAAGATCAGAACATATATGCGGTCAAATGGCAGTGAGCAAAAAGATAAAAGTGACTTGTTTAGAGCAAGATGAGGCAATCTATTTATTTAGACAAAATGTTGATATGGGGATTCTTCACTCTAGCCCTCGTATTGAAGAACTCGCTAATACTCTTGCTAAAGAACTGAGTGGCCTACCATTGGCCTTGATAACTACAGCAAGAGCAATGTCCTCAAGACATCATCCAACAGGATGGGAGGATGCAATTCGTGAGATGCATGATTTGTTCCGTCATAAGGATAATCCCTTAAACATGGAAAAGGGTGTTTACCAACCGATAAAGTTCAGTTATGACAGTCTGAGAAATGATACATTGAAACAATGTTTCTTGACATGCTCAATGTGGCCAGTGGATCAGAATATTCGAAAGGATGAACTCGTTCAGTGTTGGATGGGTCTAGGTCTAGTGGATGAGCCTAATATACGATCTTCATACAACGAAGCATATAAGCTAATTTGCGACCTTGAAGCTGCATGTTTATTAGAAAGTGGTCCAAACAATGATGTTAAAATGCAAAATGTGATCCGTGATACCGCTCTTTGGATATCTCATGGCAAGTGGGTTGTTCACACTGGAAGGAATTCATTGGATGCAAATATTGCTAGAGTTATTCAGAGATTCATTGCAGTTACATACCTTGATTTGAGCTGGAACAAACTCGAGAATATACCAGAAGAACTATGCTCCTTAACAAATTTGGAGTACCTCAATTTGTCATACAACTTTTCAATATCTGAAGTGCCCAAGTGTCTTGGATTCCTCATTAAACTCAAATTCTTGTATCTGCAAGGTACCAACATAAAGACAATACCAGACGGGGTCATATCTAGTCTGACAGAATTGCAAGTGCTAGACTTGTTGAATATGTATTTCGGAGAAGGAATAACGATGTCTCCAGTGGAGTATGTCCCAACAATATTACCTGAGTTGGGTGCCATAAATAACTTGAAAGAAGTCGATATTGTTATTGAAGGCTCATTCCAGTATGAATTACTAAGCCAATGCTGTAACCTCCCGTTAAGGCTAGTTGCTCTACGGAAAATGGAACAGTCATGTGCATTGTTCCGGCTGTCGGAAAGTATTTTTCAAGACAACTTGCTTGGAACTACTTTAAATTACCTGGAGGTTTCAGATAGCGACATGAACGTAATAGAAATTTTTAGAGGCGCTGAAGCACCGAATTATTGTTTCGAGGCTCTCAAGAAGATCGAGTTGTTTAATCTAAAAATGTTAAAACATATTAAGTGCTTCCGACTAAGTCCACATGATATGTTTCCCAGCCTCTCTGTTTTGAGGGTGTCCTTCTGCGACCGGCTAAAAAACATCTCTTGTACAATGTATTTGTCCAAACTTCAACATTTAGAGGTAAGTTACTGCAACAGTATCACGCAAGCCTTTGGGCACAACATGAACAAGTCAACGGTTCCGACATTCCCATGCCTACGGTATCTAAGCTTTGCATACCTGGATGGGTTGGAGAAGATTTGCGATTCTGATGTGACGTTCCCACAGTTAGAGACCCTGAAATTTACAGGTTGTCCAAATTTGATGAGCCTTCCATTCAAAAAGGGAACAGTACCCCTGAATCTGAGGGAGCTACAATTGGAAGATGTGAAATTATGGAAAAACTTGATATGGGAAGAAGAAGGTGTCCTAGATTTGCTGGAACCCTATCTTAAAATCAAGGAGTTGCCCACTGAAGAGGAATTAACCAAAGCACTTCAATCTATGCTTCCGTTCTATCCATGA


Protein sequences

Name Description Sequence
hypothetical protein Os09g0322800 [Oryza sativa (japonica cultivar-group)].

MNSLLKQAAYPFNIRRNVQDLITHTDDLVARRHDIARQIEAADRDGGMIPTHEARQWLDRVESARLSADTIRGRYEQRCRMFGGCSLNLWSNYRISKRAAERLAIVRSYEVVPSPITIDPPALAAVNIPIESVQIHSQESILEEALRCITEGPSAIIGICGPGGVGKTHLLKRINNNFVGDSTFRLVIFVTATRGCSVQTIQTQIMERINLNRDGDSVTRANRIVRFLKAKSFLLLVDDLWGGELEMGSVGIPYPLKNEGQLKQKVVITTRSPTICELMNVTTHVKVEVLEDDEARELFMEYNGHKGLYSDPHIGDLAKELVKELKGVASQLIHFGKEMRGRKDPKRWEDAIFVVKTSDTTHLQDEDQLSLKGTIVRNLKVATENMLARSNEVRQKIEIAERNGKTPTNGVISWLRRVDSITSSAEIICGQHQLNLDVSQSAAEKLHEVQECLDNQPSDIVVDVLQTPTEYIPIQSFELRSQNIVLQDALRYIADDSVEMIGIRGAAGVGKTHILKKINNSFHEHSDFQFVIFVTASRNIREQIARRLGINQDDRDAKLVTRISKFLEKRSFLLLVDDLREILDPKEAGIPFPLRNSSEIRQKVVFTTRSEHICGQMAVSKKIKVTCLEQDEAIYLFRQNVDMGILHSSPRIEELANTLAKELSGLPLALITTARAMSSRHHPTGWEDAIREMHDLFRHKDNPLNMEKGVYQPIKFSYDSLRNDTLKQCFLTCSMWPVDQNIRKDELVQCWMGLGLVDEPNIRSSYNEAYKLICDLEAACLLESGPNNDVKMQNVIRDTALWISHGKWVVHTGRNSLDANIARVIQRFIAVTYLDLSWNKLENIPEELCSLTNLEYLNLSYNFSISEVPKCLGFLIKLKFLYLQGTNIKTIPDGVISSLTELQVLDLLNMYFGEGITMSPVEYVPTILPELGAINNLKEVDIVIEGSFQYELLSQCCNLPLRLVALRKMEQSCALFRLSESIFQDNLLGTTLNYLEVSDSDMNVIEIFRGAEAPNYCFEALKKIELFNLKMLKHIKCFRLSPHDMFPSLSVLRVSFCDRLKNISCTMYLSKLQHLEVSYCNSITQAFGHNMNKSTVPTFPCLRYLSFAYLDGLEKICDSDVTFPQLETLKFTGCPNLMSLPFKKGTVPLNLRELQLEDVKLWKNLIWEEEGVLDLLEPYLKIKELPTEEELTKALQSMLPFYP

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF102
20-1203 PTHR23155:SF102,OS09G0322800 PROTEIN

DLITHTDDLVARRHDIARQIEAADRDGGMIPTHEARQWLDRVESARLSADTIRGRYEQRCRMFGGCSLNLWSNYRISKRAAERLAIVRSYEVVPSPITIDPPALAAVNIPIESVQIHSQESILEEALRCITEGPSAIIGICGPGGVGKTHLLKRINNNFVGDSTFRLVIFVTATRGCSVQTIQTQIMERINLNRDGDSVTRANRIVRFLKAKSFLLLVDDLWGGELEMGSVGIPYPLKNEGQLKQKVVITTRSPTICELMNVTTHVKVEVLEDDEARELFMEYNGHKGLYSDPHIGDLAKELVKELKGVASQLIHFGKEMRGRKDPKRWEDAIFVVKTSDTTHLQDEDQLSLKGTIVRNLKVATENMLARSNEVRQKIEIAERNGKTPTNGVISWLRRVDSITSSAEIICGQHQLNLDVSQSAAEKLHEVQECLDNQPSDIVVDVLQTPTEYIPIQSFELRSQNIVLQDALRYIADDSVEMIGIRGAAGVGKTHILKKINNSFHEHSDFQFVIFVTASRNIREQIARRLGINQDDRDAKLVTRISKFLEKRSFLLLVDDLREILDPKEAGIPFPLRNSSEIRQKVVFTTRSEHICGQMAVSKKIKVTCLEQDEAIYLFRQNVDMGILHSSPRIEELANTLAKELSGLPLALITTARAMSSRHHPTGWEDAIREMHDLFRHKDNPLNMEKGVYQPIKFSYDSLRNDTLKQCFLTCSMWPVDQNIRKDELVQCWMGLGLVDEPNIRSSYNEAYKLICDLEAACLLESGPNNDVKMQNVIRDTALWISHGKWVVHTGRNSLDANIARVIQRFIAVTYLDLSWNKLENIPEELCSLTNLEYLNLSYNFSISEVPKCLGFLIKLKFLYLQGTNIKTIPDGVISSLTELQVLDLLNMYFGEGITMSPVEYVPTILPELGAINNLKEVDIVIEGSFQYELLSQCCNLPLRLVALRKMEQSCALFRLSESIFQDNLLGTTLNYLEVSDSDMNVIEIFRGAEAPNYCFEALKKIELFNLKMLKHIKCFRLSPHDMFPSLSVLRVSFCDRLKNISCTMYLSKLQHLEVSYCNSITQAFGHNMNKSTVPTFPCLRYLSFAYLDGLEKICDSDVTFPQLETLKFTGCPNLMSLPFKKGTVPLNLRELQLEDVKLWKNLIWEEEGVLDLLEPYLKIKELPTEEELTKALQSMLPFYP

HMMPanther: PTHR23155
20-1203 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

DLITHTDDLVARRHDIARQIEAADRDGGMIPTHEARQWLDRVESARLSADTIRGRYEQRCRMFGGCSLNLWSNYRISKRAAERLAIVRSYEVVPSPITIDPPALAAVNIPIESVQIHSQESILEEALRCITEGPSAIIGICGPGGVGKTHLLKRINNNFVGDSTFRLVIFVTATRGCSVQTIQTQIMERINLNRDGDSVTRANRIVRFLKAKSFLLLVDDLWGGELEMGSVGIPYPLKNEGQLKQKVVITTRSPTICELMNVTTHVKVEVLEDDEARELFMEYNGHKGLYSDPHIGDLAKELVKELKGVASQLIHFGKEMRGRKDPKRWEDAIFVVKTSDTTHLQDEDQLSLKGTIVRNLKVATENMLARSNEVRQKIEIAERNGKTPTNGVISWLRRVDSITSSAEIICGQHQLNLDVSQSAAEKLHEVQECLDNQPSDIVVDVLQTPTEYIPIQSFELRSQNIVLQDALRYIADDSVEMIGIRGAAGVGKTHILKKINNSFHEHSDFQFVIFVTASRNIREQIARRLGINQDDRDAKLVTRISKFLEKRSFLLLVDDLREILDPKEAGIPFPLRNSSEIRQKVVFTTRSEHICGQMAVSKKIKVTCLEQDEAIYLFRQNVDMGILHSSPRIEELANTLAKELSGLPLALITTARAMSSRHHPTGWEDAIREMHDLFRHKDNPLNMEKGVYQPIKFSYDSLRNDTLKQCFLTCSMWPVDQNIRKDELVQCWMGLGLVDEPNIRSSYNEAYKLICDLEAACLLESGPNNDVKMQNVIRDTALWISHGKWVVHTGRNSLDANIARVIQRFIAVTYLDLSWNKLENIPEELCSLTNLEYLNLSYNFSISEVPKCLGFLIKLKFLYLQGTNIKTIPDGVISSLTELQVLDLLNMYFGEGITMSPVEYVPTILPELGAINNLKEVDIVIEGSFQYELLSQCCNLPLRLVALRKMEQSCALFRLSESIFQDNLLGTTLNYLEVSDSDMNVIEIFRGAEAPNYCFEALKKIELFNLKMLKHIKCFRLSPHDMFPSLSVLRVSFCDRLKNISCTMYLSKLQHLEVSYCNSITQAFGHNMNKSTVPTFPCLRYLSFAYLDGLEKICDSDVTFPQLETLKFTGCPNLMSLPFKKGTVPLNLRELQLEDVKLWKNLIWEEEGVLDLLEPYLKIKELPTEEELTKALQSMLPFYP

superfamily: SSF52540
115-323 SSF52540

PITIDPPALAAVNIPIESVQIHSQESILEEALRCITEGPSAIIGICGPGGVGKTHLLKRINNNFVGDSTFRLVIFVTATRGCSVQTIQTQIMERINLNRDGDSVTRANRIVRFLKAKSFLLLVDDLWGGELEMGSVGIPYPLKNEGQLKQKVVITTRSPTICELMNVTTHVKVEVLEDDEARELFMEYNGHKGLYSDPHIGDLAKELVK

Gene3D: G3DSA:3.40.50.300
140-242 G3DSA:3.40.50.300

SILEEALRCITEGPSAIIGICGPGGVGKTHLLKRINNNFVGDSTFRLVIFVTATRGCSVQTIQTQIMERINLNRDGDSVTRANRIVRFLKAKSFLLLVDDLWG

HMMSmart: SM00382
IPR003593
153-291 AAA,NBS
AAA+ ATPase domain

PSAIIGICGPGGVGKTHLLKRINNNFVGDSTFRLVIFVTATRGCSVQTIQTQIMERINLNRDGDSVTRANRIVRFLKAKSFLLLVDDLWGGELEMGSVGIPYPLKNEGQLKQKVVITTRSPTICELMNVTTHVKVEVLE

HMMPfam: PF00931
IPR002182
153-359 NB-ARC,NBS
NB-ARC

PSAIIGICGPGGVGKTHLLKRINNNFVGDSTFRLVIFVTATRGCSVQTIQTQIMERINLNRDGDSVTRANRIVRFLKAKSFLLLVDDLWGGELEMGSVGIPYPLKNEGQLKQKVVITTRSPTICELMNVTTHVKVEVLEDDEARELFMEYNGHKGLYSDPHIGDLAKELVKELKGVASQLIHFGKEMRGRKDPKRWEDAIFVVKTSD

superfamily: SSF52540
450-700 SSF52540

QECLDNQPSDIVVDVLQTPTEYIPIQSFELRSQNIVLQDALRYIADDSVEMIGIRGAAGVGKTHILKKINNSFHEHSDFQFVIFVTASRNIREQIARRLGINQDDRDAKLVTRISKFLEKRSFLLLVDDLREILDPKEAGIPFPLRNSSEIRQKVVFTTRSEHICGQMAVSKKIKVTCLEQDEAIYLFRQNVDMGILHSSPRIEELANTLAKELSGLPLALITTARAMSSRHHPTGWEDAIREMHDLFRHK

Gene3D: G3DSA:3.40.50.300
488-586 G3DSA:3.40.50.300

DALRYIADDSVEMIGIRGAAGVGKTHILKKINNSFHEHSDFQFVIFVTASRNIREQIARRLGINQDDRDAKLVTRISKFLEKRSFLLLVDDLREILDPK

HMMPfam: PF00931
IPR002182
496-759 NB-ARC,NBS
NB-ARC

DSVEMIGIRGAAGVGKTHILKKINNSFHEHSDFQFVIFVTASRNIREQIARRLGINQDDRDAKLVTRISKFLEKRSFLLLVDDLREILDPKEAGIPFPLRNSSEIRQKVVFTTRSEHICGQMAVSKKIKVTCLEQDEAIYLFRQNVDMGILHSSPRIEELANTLAKELSGLPLALITTARAMSSRHHPTGWEDAIREMHDLFRHKDNPLNMEKGVYQPIKFSYDSLRNDTLKQCFLTCSMWPVDQNIRKDELVQCWMGLGLVDE

HMMSmart: SM00382
IPR003593
497-647 AAA,NBS
AAA+ ATPase domain

SVEMIGIRGAAGVGKTHILKKINNSFHEHSDFQFVIFVTASRNIREQIARRLGINQDDRDAKLVTRISKFLEKRSFLLLVDDLREILDPKEAGIPFPLRNSSEIRQKVVFTTRSEHICGQMAVSKKIKVTCLEQDEAIYLFRQNVDMGILH

FPrintScan: PR00364
IPR000767
500-515 DISEASERSIST
Disease resistance protein

MIGIRGAAGVGKTHIL

FPrintScan: PR00364
IPR000767
566-580 DISEASERSIST
Disease resistance protein

FLEKRSFLLLVDDLR

FPrintScan: PR00364
IPR000767
663-677 DISEASERSIST
Disease resistance protein

LSGLPLALITTARAM

superfamily: SSF52058
791-1158 SSF52058,LRR

KMQNVIRDTALWISHGKWVVHTGRNSLDANIARVIQRFIAVTYLDLSWNKLENIPEELCSLTNLEYLNLSYNFSISEVPKCLGFLIKLKFLYLQGTNIKTIPDGVISSLTELQVLDLLNMYFGEGITMSPVEYVPTILPELGAINNLKEVDIVIEGSFQYELLSQCCNLPLRLVALRKMEQSCALFRLSESIFQDNLLGTTLNYLEVSDSDMNVIEIFRGAEAPNYCFEALKKIELFNLKMLKHIKCFRLSPHDMFPSLSVLRVSFCDRLKNISCTMYLSKLQHLEVSYCNSITQAFGHNMNKSTVPTFPCLRYLSFAYLDGLEKICDSDVTFPQLETLKFTGCPNLMSLPFKKGTVPLNLRELQLED

Gene3D: G3DSA:3.80.10.10
817-907 G3DSA:3.80.10.10

LDANIARVIQRFIAVTYLDLSWNKLENIPEELCSLTNLEYLNLSYNFSISEVPKCLGFLIKLKFLYLQGTNIKTIPDGVISSLTELQVLDL

HMMPfam: PF12799
832-868 LRR_4,Leucine Rich repeats (2 copies)

TYLDLSWNKLENIPEELCSLTNLEYLNLSYNFSISEV

HMMPfam: PF00560
IPR001611
877-899 LRR_1
Leucine-rich repeat

KLKFLYLQGTNIKTIPDGVISSL

Gene3D: G3DSA:3.80.10.10
990-1174 G3DSA:3.80.10.10

TTLNYLEVSDSDMNVIEIFRGAEAPNYCFEALKKIELFNLKMLKHIKCFRLSPHDMFPSLSVLRVSFCDRLKNISCTMYLSKLQHLEVSYCNSITQAFGHNMNKSTVPTFPCLRYLSFAYLDGLEKICDSDVTFPQLETLKFTGCPNLMSLPFKKGTVPLNLRELQLEDVKLWKNLIWEEEGVLD

FPrintScan: PR00364
IPR000767
1067-1083 DISEASERSIST
Disease resistance protein

MYLSKLQHLEVSYCNSI


List of References




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox