PRGDB00049962 (Os08g0293300)

From PRG Wiki
Jump to: navigation, search
Os08g0293300
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 115475747 (NM_001068005)
Gene Class NL
Domain Type NBS, LRR, LRR, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa (japonica cultivar-group) Os08g0293300 (Os08g0293300) mRNA, complete cds.

DNA Sequence

ATGGCGAAGGCGGTGGTGCTGCCGCTGGTTAGCAAGCTTCAGGAGGTGGCCCTGAGCGAGGGGAGGGCGCTGGTTGGCGTCGGCGGCGAGATCAACCGCCTCCGCGACAAGCTCATGTGGCTGATGGCCTTCCTCCAGGAGGCGGACCCCCAGAGGCGGGCGGCCGACGCCGGCGGCGAGCTCATGCGCGTGCTCGTGCACCAGACCCGCGACGCCGCGTTCAGCGCCGAGGACGCCCTCGACGACTACGCCGTCCGCGTCGACCTGTCCCGCTACCCCGGCTGGTCGCGCGCCGCCGTCGGCTTCCTCGCCGGCATCACCACCCAGCTGCGCGTCCGCCACAGGCTCTCCAGCGACATCGCGGCCATCCATGCCCGCTTTGAGGAGATCGTCGGCAACAAGGACAAGTACAGGCTGGAGGGCTCTGCGCCCTCGTCGTTGCTGACGTGGACTGCCTCCGCCGCCTCCTCGAGTGAATCAATCCTCTGGGGTACATCCAAGCCACCAATTATCGGGCGTGACGACCAGCAGCAGGAACTAGAGGCAATGCTTCTCAGCTCCGCAGGATGCCTCGCCGTAATATATGTCGTCGGCGATAGTGGTGTTGGTAAGACGATCCTTGTAAACAGTGTCTGTTCAAAACCATCTGTCAGAGAACACTTCAAAGAGCGAATTGGAGTGAAGGTCGGAAAAGATGCTGGTATATCCAACATCCTGAGTTTGATAAGCAAAGAACTGAAGAAAGAAAATAACGAAAGTGACAATGAGAATCCTAGAAGCAAGATACAAAGACGTCTTGGTGAAGAGTGCTACTTGATCATCATCGATGGCAGGCAGATGTCCATCGCTGACTGGAATGCTGTGATCCATGCTCTTCCGAAGAACGAAAGAGGTAGTCGGGTAGTGCTCATCACGAAAATAAAACCACAGTTTCTAGACCACCCAATGAATGATGTCCATGAGATAAAGCTGACATGCCTCAATCAAACGGACTGCAGGAAGCTGTTCCACATGAGGCTCCATGGCAAAGAGGAGGATGAACAAAACCAAACCTACCTGCCAATATACTACCAGCGTGTGTATGACATTACCGGGGGCTCGCCATTGGCAGTTATCCTGCTTGCTGGACTCATGCACAACAAGGAGTATCCACATGAATGGGATAGGGTGTTAAAATACCTCGAGTCAGCCAAAGAGAAGCGGCTCAACAGGATACTGTCCCTGAGCTTCGATGACCTGCACCATGAGCTCAAGCTCTGCTTCCTCTACTTCACAGCATTCCCGGTCAGCTACAAGGTGTACCAGAACGTGCTTGTCAACTTGTGGGTATCAGAGGGCTTTGTGGTGCCGCGGCACGGGAAGACGGTACAGCAACTGGGACAGCTATACCTGAGGCAGCTTACCACTAGGGGACTAGTTACTGAAGCATCAGCTGATGGTGACTACGACATCCGCCACTTTTTCCTCCATGACAGTGTCTACTTGTTTGCACGGTCAGAGGCACATGAGGCAAACTTCATGGAGCTGCATGATGGTGACTACTTCCCATCGCCGGACAGGGCTCGACGCCTCACACTACATAACAGTATGGACAGATACGCGGCACTAGATAACAAGATGCCCAAGCTACGGTCCATCTTTGCAATCTTCGAAGAGATACCAGCCAGCACAGCAGAAGAAAGTGTATCATCTCCTAGCTGCTTCCCCACCTGCTGTTCATGCGAGCAGCACAGATCACCGAAAATTTCAAGATTTGACCTCACCAAGCTGCTGAAAAGATCCAAGTTCCTACGAGTAATCATGATCGAAGGCCTGAATATCGGCACCGAGTTGCCTGAGGCAATCGGAGGCATGGTGCATCTCCGTTACCTTAGCACGCGTTGCCGATCTCTGAGGAGGATCCACCCGTCGATTGGGAATCTCAAAAATCTTCAAACAATTGATGTCAGACAAAGCTTAGTGCATGAACTGCCGTGTTCCTTTTGGAAGATCACATCGCTAAGGCATGTGTTTGGCTCTGAGCTGATCGTGCCAAGATGGACTCGTGAACTGAAACAGCTAAATACACTCAAGTCGGTGAGAGCATTGCAGGATTGGGATGGCTCTATGTTGAGAAGAATGGTTAACCTCAAGTTACTGGATGTGACTATCCAAGAGAAGCTCAAAGAGGAGAAGGCGCGCAAGTTATCAGACAACCTTAACAATCTCAACAACCTTACTACACTGATCTTGAAAGGAGTTGACCTCCCAATCTCTAGCATTTTTACGGCACCTTCCCTGCAATTCCTCAAGACTATAGAACTAACCGGAACCATCCTGCTCACAACTCCATCACCAGAAATAGACAAGATGACCACTTCACCTTCTGATTTCCAGCTGCCGAACTTGAGCAAATTGTCATTGTCAAAGACGTGTCTGCAACAAGGGTTCATTGGAAAGCTAGGCAAGCTGCCCCTTCTTTCCAATCTCACACTCAAGGATGTTTCTTGTGACGGAGAAGAGCTTGTTTTCAGGCCTGATGGGTTTCATTGCTTGAAAAAATTGGAAGTAAACGACACGTCCAAACGTGTTGTGATAGAGGAGCATGCTTTGCCTGTATTGGTCTCTTTGCATATCATTGGGAACAGTAGAAATTACCAACACTCGATCCATCCTACTCACAAGATTATCAACAAGATTAGACATGAGGACATAAATCTTTTTCAGCGTATCTGCACTTGTCATCAGAAAGAGATAACCAAAGGCTAA


Protein sequences

Name Description Sequence
hypothetical protein Os08g0293300 [Oryza sativa (japonica cultivar-group)].

MAKAVVLPLVSKLQEVALSEGRALVGVGGEINRLRDKLMWLMAFLQEADPQRRAADAGGELMRVLVHQTRDAAFSAEDALDDYAVRVDLSRYPGWSRAAVGFLAGITTQLRVRHRLSSDIAAIHARFEEIVGNKDKYRLEGSAPSSLLTWTASAASSSESILWGTSKPPIIGRDDQQQELEAMLLSSAGCLAVIYVVGDSGVGKTILVNSVCSKPSVREHFKERIGVKVGKDAGISNILSLISKELKKENNESDNENPRSKIQRRLGEECYLIIIDGRQMSIADWNAVIHALPKNERGSRVVLITKIKPQFLDHPMNDVHEIKLTCLNQTDCRKLFHMRLHGKEEDEQNQTYLPIYYQRVYDITGGSPLAVILLAGLMHNKEYPHEWDRVLKYLESAKEKRLNRILSLSFDDLHHELKLCFLYFTAFPVSYKVYQNVLVNLWVSEGFVVPRHGKTVQQLGQLYLRQLTTRGLVTEASADGDYDIRHFFLHDSVYLFARSEAHEANFMELHDGDYFPSPDRARRLTLHNSMDRYAALDNKMPKLRSIFAIFEEIPASTAEESVSSPSCFPTCCSCEQHRSPKISRFDLTKLLKRSKFLRVIMIEGLNIGTELPEAIGGMVHLRYLSTRCRSLRRIHPSIGNLKNLQTIDVRQSLVHELPCSFWKITSLRHVFGSELIVPRWTRELKQLNTLKSVRALQDWDGSMLRRMVNLKLLDVTIQEKLKEEKARKLSDNLNNLNNLTTLILKGVDLPISSIFTAPSLQFLKTIELTGTILLTTPSPEIDKMTTSPSDFQLPNLSKLSLSKTCLQQGFIGKLGKLPLLSNLTLKDVSCDGEELVFRPDGFHCLKKLEVNDTSKRVVIEEHALPVLVSLHIIGNSRNYQHSIHPTHKIINKIRHEDINLFQRICTCHQKEITKG

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF172
1-876 PTHR23155:SF172,OS08G0293300 PROTEIN

MAKAVVLPLVSKLQEVALSEGRALVGVGGEINRLRDKLMWLMAFLQEADPQRRAADAGGELMRVLVHQTRDAAFSAEDALDDYAVRVDLSRYPGWSRAAVGFLAGITTQLRVRHRLSSDIAAIHARFEEIVGNKDKYRLEGSAPSSLLTWTASAASSSESILWGTSKPPIIGRDDQQQELEAMLLSSAGCLAVIYVVGDSGVGKTILVNSVCSKPSVREHFKERIGVKVGKDAGISNILSLISKELKKENNESDNENPRSKIQRRLGEECYLIIIDGRQMSIADWNAVIHALPKNERGSRVVLITKIKPQFLDHPMNDVHEIKLTCLNQTDCRKLFHMRLHGKEEDEQNQTYLPIYYQRVYDITGGSPLAVILLAGLMHNKEYPHEWDRVLKYLESAKEKRLNRILSLSFDDLHHELKLCFLYFTAFPVSYKVYQNVLVNLWVSEGFVVPRHGKTVQQLGQLYLRQLTTRGLVTEASADGDYDIRHFFLHDSVYLFARSEAHEANFMELHDGDYFPSPDRARRLTLHNSMDRYAALDNKMPKLRSIFAIFEEIPASTAEESVSSPSCFPTCCSCEQHRSPKISRFDLTKLLKRSKFLRVIMIEGLNIGTELPEAIGGMVHLRYLSTRCRSLRRIHPSIGNLKNLQTIDVRQSLVHELPCSFWKITSLRHVFGSELIVPRWTRELKQLNTLKSVRALQDWDGSMLRRMVNLKLLDVTIQEKLKEEKARKLSDNLNNLNNLTTLILKGVDLPISSIFTAPSLQFLKTIELTGTILLTTPSPEIDKMTTSPSDFQLPNLSKLSLSKTCLQQGFIGKLGKLPLLSNLTLKDVSCDGEELVFRPDGFHCLKKLEVNDTSKRVVIEEHALPVLVSLHIIGNS

HMMPanther: PTHR23155
1-876 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

MAKAVVLPLVSKLQEVALSEGRALVGVGGEINRLRDKLMWLMAFLQEADPQRRAADAGGELMRVLVHQTRDAAFSAEDALDDYAVRVDLSRYPGWSRAAVGFLAGITTQLRVRHRLSSDIAAIHARFEEIVGNKDKYRLEGSAPSSLLTWTASAASSSESILWGTSKPPIIGRDDQQQELEAMLLSSAGCLAVIYVVGDSGVGKTILVNSVCSKPSVREHFKERIGVKVGKDAGISNILSLISKELKKENNESDNENPRSKIQRRLGEECYLIIIDGRQMSIADWNAVIHALPKNERGSRVVLITKIKPQFLDHPMNDVHEIKLTCLNQTDCRKLFHMRLHGKEEDEQNQTYLPIYYQRVYDITGGSPLAVILLAGLMHNKEYPHEWDRVLKYLESAKEKRLNRILSLSFDDLHHELKLCFLYFTAFPVSYKVYQNVLVNLWVSEGFVVPRHGKTVQQLGQLYLRQLTTRGLVTEASADGDYDIRHFFLHDSVYLFARSEAHEANFMELHDGDYFPSPDRARRLTLHNSMDRYAALDNKMPKLRSIFAIFEEIPASTAEESVSSPSCFPTCCSCEQHRSPKISRFDLTKLLKRSKFLRVIMIEGLNIGTELPEAIGGMVHLRYLSTRCRSLRRIHPSIGNLKNLQTIDVRQSLVHELPCSFWKITSLRHVFGSELIVPRWTRELKQLNTLKSVRALQDWDGSMLRRMVNLKLLDVTIQEKLKEEKARKLSDNLNNLNNLTTLILKGVDLPISSIFTAPSLQFLKTIELTGTILLTTPSPEIDKMTTSPSDFQLPNLSKLSLSKTCLQQGFIGKLGKLPLLSNLTLKDVSCDGEELVFRPDGFHCLKKLEVNDTSKRVVIEEHALPVLVSLHIIGNS

superfamily: SSF52540
168-402 SSF52540

PPIIGRDDQQQELEAMLLSSAGCLAVIYVVGDSGVGKTILVNSVCSKPSVREHFKERIGVKVGKDAGISNILSLISKELKKENNESDNENPRSKIQRRLGEECYLIIIDGRQMSIADWNAVIHALPKNERGSRVVLITKIKPQFLDHPMNDVHEIKLTCLNQTDCRKLFHMRLHGKEEDEQNQTYLPIYYQRVYDITGGSPLAVILLAGLMHNKEYPHEWDRVLKYLESAKEKRL

Gene3D: G3DSA:3.40.50.300
171-276 G3DSA:3.40.50.300

IGRDDQQQELEAMLLSSAGCLAVIYVVGDSGVGKTILVNSVCSKPSVREHFKERIGVKVGKDAGISNILSLISKELKKENNESDNENPRSKIQRRLGEECYLIIID

HMMPfam: PF00931
IPR002182
175-452 NB-ARC,NBS
NB-ARC

DQQQELEAMLLSSAGCLAVIYVVGDSGVGKTILVNSVCSKPSVREHFKERIGVKVGKDAGISNILSLISKELKKENNESDNENPRSKIQRRLGEECYLIIIDGRQMSIADWNAVIHALPKNERGSRVVLITKIKPQFLDHPMNDVHEIKLTCLNQTDCRKLFHMRLHGKEEDEQNQTYLPIYYQRVYDITGGSPLAVILLAGLMHNKEYPHEWDRVLKYLESAKEKRLNRILSLSFDDLHHELKLCFLYFTAFPVSYKVYQNVLVNLWVSEGFVVPRH

FPrintScan: PR00364
IPR000767
193-208 DISEASERSIST
Disease resistance protein

VIYVVGDSGVGKTILV

FPrintScan: PR00364
IPR000767
364-378 DISEASERSIST
Disease resistance protein

TGGSPLAVILLAGLM

superfamily: SSF52047
586-850 SSF52047,LRR

DLTKLLKRSKFLRVIMIEGLNIGTELPEAIGGMVHLRYLSTRCRSLRRIHPSIGNLKNLQTIDVRQSLVHELPCSFWKITSLRHVFGSELIVPRWTRELKQLNTLKSVRALQDWDGSMLRRMVNLKLLDVTIQEKLKEEKARKLSDNLNNLNNLTTLILKGVDLPISSIFTAPSLQFLKTIELTGTILLTTPSPEIDKMTTSPSDFQLPNLSKLSLSKTCLQQGFIGKLGKLPLLSNLTLKDVSCDGEELVFRPDGFHCLKKLEV

Gene3D: G3DSA:3.80.10.10
591-835 G3DSA:3.80.10.10

LKRSKFLRVIMIEGLNIGTELPEAIGGMVHLRYLSTRCRSLRRIHPSIGNLKNLQTIDVRQSLVHELPCSFWKITSLRHVFGSELIVPRWTRELKQLNTLKSVRALQDWDGSMLRRMVNLKLLDVTIQEKLKEEKARKLSDNLNNLNNLTTLILKGVDLPISSIFTAPSLQFLKTIELTGTILLTTPSPEIDKMTTSPSDFQLPNLSKLSLSKTCLQQGFIGKLGKLPLLSNLTLKDVSCDGEEL

FPrintScan: PR00364
IPR000767
705-721 DISEASERSIST
Disease resistance protein

RRMVNLKLLDVTIQEKL


List of References




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox