PRGDB00049964 (Os08g0260800)

From PRG Wiki
Jump to: navigation, search
Os08g0260800
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 115475588 (NM_001067926)
Gene Class NL
Domain Type LRR, NBS, LRR, LRR, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa (japonica cultivar-group) Os08g0260800 (Os08g0260800) mRNA, complete cds.

DNA Sequence

ATGGCTGAGGCCGTGATTCTTTTTGCTGTGAGGAAGATCGGTGTTGCATTGGGAAATGAAGCAACCAGCCAGGCTGTTTCGTATTTCAGGAAGTTTGTCACGCAGCTAACAGAGCTTCAAGGCAGCATGGGCCGCATCAGGAGGGAGCTCCGGTTGATGCATGAGTTTCTCTGTCGAATGGATGTACGCAACCGTAATAACCAGACATATGAAATCTGGGTGGAGGAGGGACGAGTACTTGTACATGGGATCGAAGACATTGTGGACGAATATTTGCATCTTATCGGTCAGAAGCTTGACACTGGATGGAGCACCTATCTGAAGAAAGGAATCAAGGGACCCAATGTCGTGGTATCCCTGAACAGGATAGCTTCATTGGTTAAAGAAGCCGAGGTCAATCTGGTGCACCTGTTTCAGGCCAAGGACCGATGGGTTTTGCTTCCAAGTGACAGTAACGACAACTCAAGCTACATTGTCGAGAGATCTCAGCATTTGGCAGCCACTTCATGTTCCATCAGTGATGAAGATCTTGTGGGGATTGATGATTACAGGAGGGATTTGGAAAAGTGGCTTGAAGATGATGAACCTGCACACCTTGTGATAGCCCTGCTTGGGATGGGAGGGCTTGGCAAAACAGCCCTTGCTGCAAATATCTACAGGAGGGCGAAGGAAAAGTTTGAATGCCATGCCTGGGTATCCATCTCTCAAACATATTCAAGACAAGGTGTTTTGAGAAATTTAATTGGGAAGCTTTTCAAAGATATAGAGGACGTACCAACTGACATTGCCACGATGGACATCACATCCCTTGAAGAGAAACTGCATCTTTTTCTAGTGGAGAAGAAATACTTGATCGTACTAGATGATGTTTGGAGTACAGAAGCATTCACTGACTTGTCTAATGCACTTGTTCATAACGGCACTGGAAGCAGGCTTGTAATTACAACACGAGACAGTGAAGTAGCCGGCCTTGCTTCTAAGAATTATGTCGTTGAACTGAAAACTTTACCAAGTGACAAGGCAATGGAGTTGTTCTGTAAAAAGGCCTTCCGGAGTGATACAGATGACAAATGTCTTGCAAAGCTAAATGATATTTCCGTGGAAATCGTCAGCAAGTGCAAAGGCTTGCCTCTTGCTATTGTCTCTGTTGGTAGTCTCTTGTTTGTGCAAAGGTTCATTGTGGAAAAGGGTGAAAGCACACTAGAGGAAGTGGCAGAAGGCTACCTAAAAGAGTTGGTTCACAGGAACATGCTGCAACTGGTCCAAAAGAACTCATTTGGTAGGATAAGAAGATTCAAAATGCACGATATCGTGCGTGAGCTCGCGGTTGACTTGTGTCGGAGAGAATGTTTTGGCATTACATATGAGGATGGTCATCATGGGAGATCCCTTGAGGAAAATGATGAACGTCGACTGGTAATACAAAAATTCCACGAGGACGTTGGTCAGTCGGTTTTAGGTGTGTACCGGCTCCGCTCTATCATTGTCCTGGATAAGAGCACTCCATCATCCATTATTTTATCCTCTGTGTTGGACAACTCCAGGTACATGTCCGTGCTTGAGCTAAGTGGAGTACCCATCAAGACAGTTCCCAATGCTATTGGTAATCTTTTCAATCTGCACCATTTGGGTCTGCGAGGCTCAAAGTCCATCGAGAAGTTGTCCAATCTGCTGACGCTGGACCTTTCTGGATCAGACATACGGTGTCTGCCAAGAAGGATCGTCAAGCTGAAGAAGCTTAGGCACTTATTTGCCGAGAAACTGCACGATGCAACCTGGAGAAATTTCCGTTGCTGCACTGGTGTGCGCTTCCACAAGGGTCTCGGTAACCTGACGAGCCTTCGGACGCTACATGGGCTGGAGGCACAGGAGGAGTCCATCAGGCATCTCGGAGAGCTGAGGCAGCTACGAAGCCTCAGAGTATGGAACGTGAAAGGAGCCTACAGTGGACGCCTTTGCACATCTCTTGTTAAGCTACAATTCCTGTCCAACCTGTACATTGTGGCGAGCAACGAAAACGAGGCTCTCCAGCTGGAAGAGATGAACCCGCCGCCTCCCAACCTTCAGAGGCTGTTCTTGCGAGGGCGGCTAGCAGATGATATACTGCAGGAGGAGTCTCCCCTCTTCCATCACGCAGCAAGGCGAAACCTGTATGAGCTACGGCTGTATTGGTCCCAATTGGAACAAGACCCTCTGCCATCCCTCTCCCTGCTGTTGAATCTGACAGACCTGAGGCTAACCAACACATACATTGGAGAGAGGCTGGTGTTTCTTTCTGAGTGGTTTCCCAACCTTAGGATACTCTTCTTAAGAGACATGCGTAATCTGAAATGGCTGGTGGTTCAAAAAGACGCCATGAAGAAACTGCAACGGCTAACACTGGTTAACCTCAAAAACATGAGGGACGTCCCGTTGGGCATTCAGTTCCTCATGCCCCTGAAATATCTAGGCTTTCTGGAAATCACCAAGGAATTCCTTGAGTTATTGCAGTCCTCTTCGATTAAAGATTTTCGGTGGCAGCATTCTCTTCGAGACTCTGAGACCAGTGTTGATATCTAG


Protein sequences

Name Description Sequence
hypothetical protein Os08g0260800 [Oryza sativa (japonica cultivar-group)].

MAEAVILFAVRKIGVALGNEATSQAVSYFRKFVTQLTELQGSMGRIRRELRLMHEFLCRMDVRNRNNQTYEIWVEEGRVLVHGIEDIVDEYLHLIGQKLDTGWSTYLKKGIKGPNVVVSLNRIASLVKEAEVNLVHLFQAKDRWVLLPSDSNDNSSYIVERSQHLAATSCSISDEDLVGIDDYRRDLEKWLEDDEPAHLVIALLGMGGLGKTALAANIYRRAKEKFECHAWVSISQTYSRQGVLRNLIGKLFKDIEDVPTDIATMDITSLEEKLHLFLVEKKYLIVLDDVWSTEAFTDLSNALVHNGTGSRLVITTRDSEVAGLASKNYVVELKTLPSDKAMELFCKKAFRSDTDDKCLAKLNDISVEIVSKCKGLPLAIVSVGSLLFVQRFIVEKGESTLEEVAEGYLKELVHRNMLQLVQKNSFGRIRRFKMHDIVRELAVDLCRRECFGITYEDGHHGRSLEENDERRLVIQKFHEDVGQSVLGVYRLRSIIVLDKSTPSSIILSSVLDNSRYMSVLELSGVPIKTVPNAIGNLFNLHHLGLRGSKSIEKLSNLLTLDLSGSDIRCLPRRIVKLKKLRHLFAEKLHDATWRNFRCCTGVRFHKGLGNLTSLRTLHGLEAQEESIRHLGELRQLRSLRVWNVKGAYSGRLCTSLVKLQFLSNLYIVASNENEALQLEEMNPPPPNLQRLFLRGRLADDILQEESPLFHHAARRNLYELRLYWSQLEQDPLPSLSLLLNLTDLRLTNTYIGERLVFLSEWFPNLRILFLRDMRNLKWLVVQKDAMKKLQRLTLVNLKNMRDVPLGIQFLMPLKYLGFLEITKEFLELLQSSSIKDFRWQHSLRDSETSVDI

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF170
11-821 OS08G0260800 PROTEIN,OS08G0260800 PROTEIN

RKIGVALGNEATSQAVSYFRKFVTQLTELQGSMGRIRRELRLMHEFLCRMDVRNRNNQTYEIWVEEGRVLVHGIEDIVDEYLHLIGQKLDTGWSTYLKKGIKGPNVVVSLNRIASLVKEAEVNLVHLFQAKDRWVLLPSDSNDNSSYIVERSQHLAATSCSISDEDLVGIDDYRRDLEKWLEDDEPAHLVIALLGMGGLGKTALAANIYRRAKEKFECHAWVSISQTYSRQGVLRNLIGKLFKDIEDVPTDIATMDITSLEEKLHLFLVEKKYLIVLDDVWSTEAFTDLSNALVHNGTGSRLVITTRDSEVAGLASKNYVVELKTLPSDKAMELFCKKAFRSDTDDKCLAKLNDISVEIVSKCKGLPLAIVSVGSLLFVQRFIVEKGESTLEEVAEGYLKELVHRNMLQLVQKNSFGRIRRFKMHDIVRELAVDLCRRECFGITYEDGHHGRSLEENDERRLVIQKFHEDVGQSVLGVYRLRSIIVLDKSTPSSIILSSVLDNSRYMSVLELSGVPIKTVPNAIGNLFNLHHLGLRGSKSIEKLSNLLTLDLSGSDIRCLPRRIVKLKKLRHLFAEKLHDATWRNFRCCTGVRFHKGLGNLTSLRTLHGLEAQEESIRHLGELRQLRSLRVWNVKGAYSGRLCTSLVKLQFLSNLYIVASNENEALQLEEMNPPPPNLQRLFLRGRLADDILQEESPLFHHAARRNLYELRLYWSQLEQDPLPSLSLLLNLTDLRLTNTYIGERLVFLSEWFPNLRILFLRDMRNLKWLVVQKDAMKKLQRLTLVNLKNMRDVPLGIQFLMPLKYLGFLEI

HMMPanther: PTHR23155
11-821 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

RKIGVALGNEATSQAVSYFRKFVTQLTELQGSMGRIRRELRLMHEFLCRMDVRNRNNQTYEIWVEEGRVLVHGIEDIVDEYLHLIGQKLDTGWSTYLKKGIKGPNVVVSLNRIASLVKEAEVNLVHLFQAKDRWVLLPSDSNDNSSYIVERSQHLAATSCSISDEDLVGIDDYRRDLEKWLEDDEPAHLVIALLGMGGLGKTALAANIYRRAKEKFECHAWVSISQTYSRQGVLRNLIGKLFKDIEDVPTDIATMDITSLEEKLHLFLVEKKYLIVLDDVWSTEAFTDLSNALVHNGTGSRLVITTRDSEVAGLASKNYVVELKTLPSDKAMELFCKKAFRSDTDDKCLAKLNDISVEIVSKCKGLPLAIVSVGSLLFVQRFIVEKGESTLEEVAEGYLKELVHRNMLQLVQKNSFGRIRRFKMHDIVRELAVDLCRRECFGITYEDGHHGRSLEENDERRLVIQKFHEDVGQSVLGVYRLRSIIVLDKSTPSSIILSSVLDNSRYMSVLELSGVPIKTVPNAIGNLFNLHHLGLRGSKSIEKLSNLLTLDLSGSDIRCLPRRIVKLKKLRHLFAEKLHDATWRNFRCCTGVRFHKGLGNLTSLRTLHGLEAQEESIRHLGELRQLRSLRVWNVKGAYSGRLCTSLVKLQFLSNLYIVASNENEALQLEEMNPPPPNLQRLFLRGRLADDILQEESPLFHHAARRNLYELRLYWSQLEQDPLPSLSLLLNLTDLRLTNTYIGERLVFLSEWFPNLRILFLRDMRNLKWLVVQKDAMKKLQRLTLVNLKNMRDVPLGIQFLMPLKYLGFLEI

superfamily: SSF52540
157-412 P-loop containing nucleoside triphosphate hydrolases

YIVERSQHLAATSCSISDEDLVGIDDYRRDLEKWLEDDEPAHLVIALLGMGGLGKTALAANIYRRAKEKFECHAWVSISQTYSRQGVLRNLIGKLFKDIEDVPTDIATMDITSLEEKLHLFLVEKKYLIVLDDVWSTEAFTDLSNALVHNGTGSRLVITTRDSEVAGLASKNYVVELKTLPSDKAMELFCKKAFRSDTDDKCLAKLNDISVEIVSKCKGLPLAIVSVGSLLFVQRFIVEKGESTLEEVAEGYLKEL

Gene3D: G3DSA:3.40.50.300
173-319 no description

SDEDLVGIDDYRRDLEKWLEDDEPAHLVIALLGMGGLGKTALAANIYRRAKEKFECHAWVSISQTYSRQGVLRNLIGKLFKDIEDVPTDIATMDITSLEEKLHLFLVEKKYLIVLDDVWSTEAFTDLSNALVHNGTGSRLVITTRDS

HMMPfam: PF00931
IPR002182
186-405 NB-ARC,NBS
NB-ARC

DLEKWLEDDEPAHLVIALLGMGGLGKTALAANIYRRAKEKFECHAWVSISQTYSRQGVLRNLIGKLFKDIEDVPTDIATMDITSLEEKLHLFLVEKKYLIVLDDVWSTEAFTDLSNALVHNGTGSRLVITTRDSEVAGLASKNYVVELKTLPSDKAMELFCKKAFRSDTDDKCLAKLNDISVEIVSKCKGLPLAIVSVGSLLFVQRFIVEKGESTLEEVA

FPrintScan: PR00364
IPR000767
200-215 DISEASERSIST
Disease resistance protein

VIALLGMGGLGKTALA

FPrintScan: PR00364
IPR000767
277-291 DISEASERSIST
Disease resistance protein

FLVEKKYLIVLDDVW

FPrintScan: PR00364
IPR000767
373-387 DISEASERSIST
Disease resistance protein

CKGLPLAIVSVGSLL

superfamily: SSF52058
433-818 L domain-like,LRR

KMHDIVRELAVDLCRRECFGITYEDGHHGRSLEENDERRLVIQKFHEDVGQSVLGVYRLRSIIVLDKSTPSSIILSSVLDNSRYMSVLELSGVPIKTVPNAIGNLFNLHHLGLRGSKSIEKLSNLLTLDLSGSDIRCLPRRIVKLKKLRHLFAEKLHDATWRNFRCCTGVRFHKGLGNLTSLRTLHGLEAQEESIRHLGELRQLRSLRVWNVKGAYSGRLCTSLVKLQFLSNLYIVASNENEALQLEEMNPPPPNLQRLFLRGRLADDILQEESPLFHHAARRNLYELRLYWSQLEQDPLPSLSLLLNLTDLRLTNTYIGERLVFLSEWFPNLRILFLRDMRNLKWLVVQKDAMKKLQRLTLVNLKNMRDVPLGIQFLMPLKYLGF

Gene3D: G3DSA:3.80.10.10
488-694 no description

VYRLRSIIVLDKSTPSSIILSSVLDNSRYMSVLELSGVPIKTVPNAIGNLFNLHHLGLRGSKSIEKLSNLLTLDLSGSDIRCLPRRIVKLKKLRHLFAEKLHDATWRNFRCCTGVRFHKGLGNLTSLRTLHGLEAQEESIRHLGELRQLRSLRVWNVKGAYSGRLCTSLVKLQFLSNLYIVASNENEALQLEEMNPPPPNLQRLFLR

FPrintScan: PR00364
IPR000767
552-568 DISEASERSIST
Disease resistance protein

EKLSNLLTLDLSGSDIR

Gene3D: G3DSA:3.80.10.10
715-816 no description

RNLYELRLYWSQLEQDPLPSLSLLLNLTDLRLTNTYIGERLVFLSEWFPNLRILFLRDMRNLKWLVVQKDAMKKLQRLTLVNLKNMRDVPLGIQFLMPLKYL

Seg: seg
726-748 seg

QLEQDPLPSLSLLLNLTDLRLTN


List of References




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox