PRGDB00050025 (Os04g0118800)

From PRG Wiki
Jump to: navigation, search
Os04g0118800
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 115456919 (NM_001058595)
Gene Class CNL
Domain Type NBS, LRR, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa (japonica cultivar-group) Os04g0118800 (Os04g0118800) mRNA, complete cds.

DNA Sequence

ATGGATGAAGATGGAAACGTGGGGATTGGAGGCAAATACACAGATGGGCTCATTTCTCATTCACTCAGAGTGTCAAAACAGCGATCATGCGTCCACAAGTACGCTGCCGGAGCCAATGTCAGCCTGCAATGCAGGTCATCAAAGCAGGAGCATATGAGCACCACTGAGGTCAGATTTGAGGACTGGATGGCAGAGGCTGTGGTGTTTGGAATCCTATGCAAGATTGGATCCATCTTGAGTTCACATCTAACACAGGCGTTCGTTGCACACTTGGGAAAGGAGGTATCAGTTTTCATTGAAATTGAAAGCAGTATTAAGCAAATCAGAAGTGAGTTTAGGTTGATGCAAGCTTTCCTGCAAGACGGCCAAGAAAAAGAAAGTCATAGCAGGCTGGCAGAAACCTTTCTACACGAAGTTCAGCAGGTATCATTTGAAGTTGAAGACATTCTGGATGAATTTGTCTATTTGTTTGGCCAAAAACAAACCGCATCTCTAAAATCATTGAGGAACTTCTTTCCAAAATCTAAAAGTATGATGCACTGGCAGAGACTAGCAGCAGAGCTCAAAGAAGCGCAGAACCGCCTCCAGAATTTGCGAAATTTGAAGGTTCAGTACAATATTGACTTATCCGAAGAAAGTCCTAGTTCTATCAGGTATGAAGATAGCCAAGTTCACACAATCCAACACATAAAGCATAATAACAAAATTGTTGGTTTTGCAAACGAGCGAGACTGCCTACAAGAGCTGCTGATGACAAACGAGAAATCATGCTCAATAATTTCCATATGGGGCATGGGAGGTTCAGGTAAAACTACTCTTGTCAAAACTGTTTTTGAAAGAAAAGCTATCAAGAATCGTTTTGATTGCCTGATCTGGGTAACTGTGTCACAAACATATGACATTACTGAAATAATGAGAAAGATTATACAATGTGCATTGAAGGAAACTTGCCCAGCTGACCTAGAAAGCATGTGTAGTGAAGGTGTAGCCCTGAAGCTCCAGGGGACTTTGCAGGGAAGGACATACATGATGATCTTGGATGATGTGTGGGATACAAATGTTTGGTTCAACTTGGAACCTTTTCTAGATTTGAACAGCAGAGGAAGCAAGGTTGTAATTACTACTCGCATAAACGATGTTGCTTCTTTGGCAGATGACAAGAACCGCCTTCAACTACGAGGACTAAACGAGGCAGAGTCTTGGGACCTCTTTTGCATGTGGGCATTCAGACATACTGAAGATCAAACATGTCCTCTCAGATTGGAGAGAGTAGCAAGACAGATTGTTGGCAGGTGTGAAGGTCTGCCATTAGCTATAACGGCTGTAGGCAATTTGCTATCATTCAAAAGACTGGATTCGTTTGAGTGGGATAAATTCTATAATCAACTAAATTGGGAATTGCACAATCGATTGGATAACCAAGGACTTAACATGGTGACCCGACTCCTAGGTTTAAGCTACAGGCATCTACCAGCCCACTTGAAGAACTGTTTCCTTTTGTCCAGTATCTTTCCAGAGGACTATATGATACACGGGAAGTGGCTAAGTAGACTGTTAATAGCAGAAGGTTTAGTTGAACCAAGGAAAAATATGACACTGGAGGAGATTGCAACAGAGTACATTGAAAAGCTAGTAGATCGCTGCCTGCTCCAAGTTGTCAGGAGGGATAAGCTTGGAAGAATATGGCAACTCCAGATGCATGACATTGTGAGGGAACTGGCAATTTCAATATCTGAAAAGGAAGGATTCTGCATGATTTATACTAGTAAAGAAGCACATACATCAGTGGTTGGGTGCGAGCCTCGTCGTTTATCAGTTCATGAGAATTATGACAGAGTCCAGCAAATTATAAATGCTCAACGTATTCGTTCTTTCTACCCATATCAATTGGATAGTGATTATTCCGTGATGTCAAATGTGCAATGGGTGTCAACAAGTGCTAGATACTTGAAGACGAACCAAGGTCAAGCAACTTCCTGA


Protein sequences

Name Description Sequence
hypothetical protein Os04g0118800 [Oryza sativa (japonica cultivar-group)].

MDEDGNVGIGGKYTDGLISHSLRVSKQRSCVHKYAAGANVSLQCRSSKQEHMSTTEVRFEDWMAEAVVFGILCKIGSILSSHLTQAFVAHLGKEVSVFIEIESSIKQIRSEFRLMQAFLQDGQEKESHSRLAETFLHEVQQVSFEVEDILDEFVYLFGQKQTASLKSLRNFFPKSKSMMHWQRLAAELKEAQNRLQNLRNLKVQYNIDLSEESPSSIRYEDSQVHTIQHIKHNNKIVGFANERDCLQELLMTNEKSCSIISIWGMGGSGKTTLVKTVFERKAIKNRFDCLIWVTVSQTYDITEIMRKIIQCALKETCPADLESMCSEGVALKLQGTLQGRTYMMILDDVWDTNVWFNLEPFLDLNSRGSKVVITTRINDVASLADDKNRLQLRGLNEAESWDLFCMWAFRHTEDQTCPLRLERVARQIVGRCEGLPLAITAVGNLLSFKRLDSFEWDKFYNQLNWELHNRLDNQGLNMVTRLLGLSYRHLPAHLKNCFLLSSIFPEDYMIHGKWLSRLLIAEGLVEPRKNMTLEEIATEYIEKLVDRCLLQVVRRDKLGRIWQLQMHDIVRELAISISEKEGFCMIYTSKEAHTSVVGCEPRRLSVHENYDRVQQIINAQRIRSFYPYQLDSDYSVMSNVQWVSTSARYLKTNQGQATS

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
73-651 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

CKIGSILSSHLTQAFVAHLGKEVSVFIEIESSIKQIRSEFRLMQAFLQDGQEKESHSRLAETFLHEVQQVSFEVEDILDEFVYLFGQKQTASLKSLRNFFPKSKSMMHWQRLAAELKEAQNRLQNLRNLKVQYNIDLSEESPSSIRYEDSQVHTIQHIKHNNKIVGFANERDCLQELLMTNEKSCSIISIWGMGGSGKTTLVKTVFERKAIKNRFDCLIWVTVSQTYDITEIMRKIIQCALKETCPADLESMCSEGVALKLQGTLQGRTYMMILDDVWDTNVWFNLEPFLDLNSRGSKVVITTRINDVASLADDKNRLQLRGLNEAESWDLFCMWAFRHTEDQTCPLRLERVARQIVGRCEGLPLAITAVGNLLSFKRLDSFEWDKFYNQLNWELHNRLDNQGLNMVTRLLGLSYRHLPAHLKNCFLLSSIFPEDYMIHGKWLSRLLIAEGLVEPRKNMTLEEIATEYIEKLVDRCLLQVVRRDKLGRIWQLQMHDIVRELAISISEKEGFCMIYTSKEAHTSVVGCEPRRLSVHENYDRVQQIINAQRIRSFYPYQLDSDYSVMSNVQWVSTSARYLK

HMMPanther: PTHR23155:SF222
73-651 OS12G0246700 PROTEIN,OS12G0246700 PROTEIN

CKIGSILSSHLTQAFVAHLGKEVSVFIEIESSIKQIRSEFRLMQAFLQDGQEKESHSRLAETFLHEVQQVSFEVEDILDEFVYLFGQKQTASLKSLRNFFPKSKSMMHWQRLAAELKEAQNRLQNLRNLKVQYNIDLSEESPSSIRYEDSQVHTIQHIKHNNKIVGFANERDCLQELLMTNEKSCSIISIWGMGGSGKTTLVKTVFERKAIKNRFDCLIWVTVSQTYDITEIMRKIIQCALKETCPADLESMCSEGVALKLQGTLQGRTYMMILDDVWDTNVWFNLEPFLDLNSRGSKVVITTRINDVASLADDKNRLQLRGLNEAESWDLFCMWAFRHTEDQTCPLRLERVARQIVGRCEGLPLAITAVGNLLSFKRLDSFEWDKFYNQLNWELHNRLDNQGLNMVTRLLGLSYRHLPAHLKNCFLLSSIFPEDYMIHGKWLSRLLIAEGLVEPRKNMTLEEIATEYIEKLVDRCLLQVVRRDKLGRIWQLQMHDIVRELAISISEKEGFCMIYTSKEAHTSVVGCEPRRLSVHENYDRVQQIINAQRIRSFYPYQLDSDYSVMSNVQWVSTSARYLK

Coil: coil
181-209 coiled-coil

WQRLAAELKEAQNRLQNLRNLKVQYNIDL

superfamily: SSF52540
217-471 P-loop containing nucleoside triphosphate hydrolases

IRYEDSQVHTIQHIKHNNKIVGFANERDCLQELLMTNEKSCSIISIWGMGGSGKTTLVKTVFERKAIKNRFDCLIWVTVSQTYDITEIMRKIIQCALKETCPADLESMCSEGVALKLQGTLQGRTYMMILDDVWDTNVWFNLEPFLDLNSRGSKVVITTRINDVASLADDKNRLQLRGLNEAESWDLFCMWAFRHTEDQTCPLRLERVARQIVGRCEGLPLAITAVGNLLSFKRLDSFEWDKFYNQLNWELHNRL

HMMPfam: PF00931
IPR002182
245-529 NB-ARC,NBS
NB-ARC

CLQELLMTNEKSCSIISIWGMGGSGKTTLVKTVFERKAIKNRFDCLIWVTVSQTYDITEIMRKIIQCALKETCPADLESMCSEGVALKLQGTLQGRTYMMILDDVWDTNVWFNLEPFLDLNSRGSKVVITTRINDVASLADDKNRLQLRGLNEAESWDLFCMWAFRHTEDQTCPLRLERVARQIVGRCEGLPLAITAVGNLLSFKRLDSFEWDKFYNQLNWELHNRLDNQGLNMVTRLLGLSYRHLPAHLKNCFLLSSIFPEDYMIHGKWLSRLLIAEGLVEPRK

Seg: seg
256-269 seg

SCSIISIWGMGGSG

FPrintScan: PR00364
IPR000767
259-274 DISEASERSIST
Disease resistance protein

IISIWGMGGSGKTTLV

FPrintScan: PR00364
IPR000767
336-350 DISEASERSIST
Disease resistance protein

TLQGRTYMMILDDVW

FPrintScan: PR00364
IPR000767
432-446 DISEASERSIST
Disease resistance protein

CEGLPLAITAVGNLL


List of References

Hajime Ohyanagi, Tsuyoshi Tanaka, Hiroaki Sakai, Yasumasa Shigemoto, Kaori Yamaguchi, Takuya Habara, Yasuyuki Fujii, Baltazar A Antonio, Yoshiaki Nagamura, Tadashi Imanishi, Kazuho Ikeo, Takeshi Itoh, Takashi Gojobori, Takuji Sasaki
The Rice Annotation Project Database (RAP-DB): hub for Oryza sativa ssp. japonica genome information.
Nucleic Acids Res.: 2006, 34(Database issue);D741-4
PubMed:16381971 WorldCat.org DOI (I p)


The map-based sequence of the rice genome.
Nature: 2005, 436(7052);793-800
PubMed:16100779 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox