PRGDB00050062 (OJ9003_G05.38)

From PRG Wiki
Jump to: navigation, search
OJ9003_G05.38
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 49389237 (AP004126)
Gene Class Unknown
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OJ9003_G05.

DNA Sequence

ATGCATGATCTGAGCAACCTTGCAGGCTCTGCTGCGTTGATGGTCAGTCAACTTCACTCAACAACTAAGGCTACTGATGATTCAGGAGCAGAAACTGAAGCAGAAGCACTCCTCCGATGGAAGTCCACTTTGATCGACGCCACCAACTCGTTGTCGTCATGGTCGATTGCCAACTCCACCTGCTCTTGGTTCGGTGTCACCTGTGACGCCGCCGGCCATGTCACTGAGCTCGACCTTCTTGGTGCCGACATCAATGGTACGCTTGACGCTCTCTACTCTGCTGCATTCGAAAACCTCACCACCATCGACCTCAGCCACAATAATCTTGATGGTGCCATTCCAGCAAATATTTCTATGTTGCACACCCTCACCGTTCTAGATTTGAGCGTCAATAATCTTACTGGTACGATCCCCTACCAACTCAGCAAGCTCCCTAGACTCGCCCACTTAAATCTTGGAGATAACCACTTGACCAATCCGGAATATGCCATGTTCTTCACACCCATGCCCTGTTTGGAATTCCTATCTCTATTTCACAATCATCTCAATGGTACTTTTCCAGAATTCATCCTCAATAGCACTAGTTTGAGGATGGAGCACCTCGATTTATCGGGTAATGCTTTCTCAGGGCCCATACCAGATTCACTACCAGAGATTGCTCCAAATTTGAGGCATCTAGATCTGTCGTACAATGGATTCCATGGGTCCATACCACATTCACTCTCAAGGCTGCAAAAGCTCCGAGAACTATATCTGCACAGAAACAACCTCACCCGAGCAATCCCAGAGGAGCTTGGGAACCTAACCAATCTTGAGGAGCTGGTCCTGTCAAGCAACCGGTTAGTTGGAAGTTTGCCACCATCTTTTGCCAGGATGCAACAATTATCATTTTTTGCGATAGACAATAACTACATCAATGGTAGTATCCCGTTGGAGATGTTTTCAAACTGCACTCAGCTCATGATTTTTGATGTTTCCAACAACATGTTAACTGGAAGCATCCCATCACTGATCAGCAACTGGACACACCTACAGTACTTGTTCCTCTTCAACAACACATTTACCGGTGCAATCCCAAGGGAGATAGGAAACTTAGCACAATTACTTTCAGTGGACATGTCACAAAATCTCTTTACCGGAAAGATACCATTAAATATCTGCAATGCATCTTTGCTATACCTTGTAATCAGTCACAACTATCTGGAAGGTGAGCTCCCTGAATGCTTGTGGAATTTGAAAGATCTCGGATACATGGATTTGTCAAGCAACGCTTTTTCTGGAGAAGTTACAACCTCAAGTAACTATGAATCCTCCCTAAAATCACTGTACCTGTCAAATAATAACTTATCGGGTCGTTTTCCAACGGTATTGAAGAACCTCAAAAACCTAACTGTGTTGGATCTTGTGCATAATAAGATTTCTGGTGTGATTCCTTCATGGATTGGGGAAAGCAATCCTTTGCTGAGGATTCTCCGATTACGATCAAACTTGTTCCATGGAAGTATTCCTTGTCAACTGTCAAAACTCTCCCAACTCCAACTGCTTGATCTGGCTGAAAATAATTTTACAGGTCCTGTACCAAGTAGTTTCGCCAACTTATCCTCCATGCAGCCTGAAACAAGAGACAAATTCTCCTCCGGTGAAACATATTACATTAACATTATTTGGAAGGGAATGGAGTACACTTTTCAGGAAAGAGATGATTGTGTTATTGGTATTGATCTTTCAAGCAATTCTCTCTCTGGTGAGATCCCTTCAGAGTTGACAAATCTTAGAGGCCTTCAGTTCTTAAATATGTCAAGAAATGTTCTATATGGTGGCATCCCAAATGACATTGGCCATCTACATGTTGTAGAGTCTCTTGACCTCTCTTGCAATAGACTCTTGGGTCCTATTCCTCCTAGCATATCAAACTTGACGGGCCTCAGCAAGCTTAATCTCTCGAACAACCTTCTATCAGGAGAGATACCTATAGGTAATCAACTCCAAACACTGGATGACCCATCGATTTATGCCAACAACCTGAGGCTTTGTGGATTTCCTTTGAAAATTCCATGCTCAAACCATTCAAATTCTACGAGTACACTAGAAGGGGCAAAAGAACATCACCAAGAACTGGAAACTCTATGGCTGTACTGCTCAGTAACTGCAGGAGCTGTCTTTGGTGTTTGGCTGTGGTTTGGAGCACTGTTTTTCTGTAATGCATGGAGGCTTGCTTTCTTCAGTCTCATCGATGCCATGCAGCAGAAACTTATGCAAACATAA


Protein sequences

Name Description Sequence
putative Hcr2-5B putative Hcr2-5B [Oryza sativa Japonica Group].

MHDLSNLAGSAALMVSQLHSTTKATDDSGAETEAEALLRWKSTLIDATNSLSSWSIANSTCSWFGVTCDAAGHVTELDLLGADINGTLDALYSAAFENLTTIDLSHNNLDGAIPANISMLHTLTVLDLSVNNLTGTIPYQLSKLPRLAHLNLGDNHLTNPEYAMFFTPMPCLEFLSLFHNHLNGTFPEFILNSTSLRMEHLDLSGNAFSGPIPDSLPEIAPNLRHLDLSYNGFHGSIPHSLSRLQKLRELYLHRNNLTRAIPEELGNLTNLEELVLSSNRLVGSLPPSFARMQQLSFFAIDNNYINGSIPLEMFSNCTQLMIFDVSNNMLTGSIPSLISNWTHLQYLFLFNNTFTGAIPREIGNLAQLLSVDMSQNLFTGKIPLNICNASLLYLVISHNYLEGELPECLWNLKDLGYMDLSSNAFSGEVTTSSNYESSLKSLYLSNNNLSGRFPTVLKNLKNLTVLDLVHNKISGVIPSWIGESNPLLRILRLRSNLFHGSIPCQLSKLSQLQLLDLAENNFTGPVPSSFANLSSMQPETRDKFSSGETYYINIIWKGMEYTFQERDDCVIGIDLSSNSLSGEIPSELTNLRGLQFLNMSRNVLYGGIPNDIGHLHVVESLDLSCNRLLGPIPPSISNLTGLSKLNLSNNLLSGEIPIGNQLQTLDDPSIYANNLRLCGFPLKIPCSNHSNSTSTLEGAKEHHQELETLWLYCSVTAGAVFGVWLWFGALFFCNAWRLAFFSLIDAMQQKLMQT


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
12-679 PTHR24420,FAMILY NOT NAMED

ALMVSQLHSTTKATDDSGAETEAEALLRWKSTLIDATNSLSSWSIANSTCSWFGVTCDAAGHVTELDLLGADINGTLDALYSAAFENLTTIDLSHNNLDGAIPANISMLHTLTVLDLSVNNLTGTIPYQLSKLPRLAHLNLGDNHLTNPEYAMFFTPMPCLEFLSLFHNHLNGTFPEFILNSTSLRMEHLDLSGNAFSGPIPDSLPEIAPNLRHLDLSYNGFHGSIPHSLSRLQKLRELYLHRNNLTRAIPEELGNLTNLEELVLSSNRLVGSLPPSFARMQQLSFFAIDNNYINGSIPLEMFSNCTQLMIFDVSNNMLTGSIPSLISNWTHLQYLFLFNNTFTGAIPREIGNLAQLLSVDMSQNLFTGKIPLNICNASLLYLVISHNYLEGELPECLWNLKDLGYMDLSSNAFSGEVTTSSNYESSLKSLYLSNNNLSGRFPTVLKNLKNLTVLDLVHNKISGVIPSWIGESNPLLRILRLRSNLFHGSIPCQLSKLSQLQLLDLAENNFTGPVPSSFANLSSMQPETRDKFSSGETYYINIIWKGMEYTFQERDDCVIGIDLSSNSLSGEIPSELTNLRGLQFLNMSRNVLYGGIPNDIGHLHVVESLDLSCNRLLGPIPPSISNLTGLSKLNLSNNLLSGEIPIGNQLQTLDDPSIYANNLRLCG

HMMPfam: PF08263
IPR013210
31-69 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

ETEAEALLRWKSTLIDATNSLSSWSIANSTCSWFGVTCD

Gene3D: G3DSA:3.80.10.10
32-249 G3DSA:3.80.10.10

TEAEALLRWKSTLIDATNSLSSWSIANSTCSWFGVTCDAAGHVTELDLLGADINGTLDALYSAAFENLTTIDLSHNNLDGAIPANISMLHTLTVLDLSVNNLTGTIPYQLSKLPRLAHLNLGDNHLTNPEYAMFFTPMPCLEFLSLFHNHLNGTFPEFILNSTSLRMEHLDLSGNAFSGPIPDSLPEIAPNLRHLDLSYNGFHGSIPHSLSRLQKLRE

superfamily: SSF52047
76-388 SSF52047,LRR

ELDLLGADINGTLDALYSAAFENLTTIDLSHNNLDGAIPANISMLHTLTVLDLSVNNLTGTIPYQLSKLPRLAHLNLGDNHLTNPEYAMFFTPMPCLEFLSLFHNHLNGTFPEFILNSTSLRMEHLDLSGNAFSGPIPDSLPEIAPNLRHLDLSYNGFHGSIPHSLSRLQKLRELYLHRNNLTRAIPEELGNLTNLEELVLSSNRLVGSLPPSFARMQQLSFFAIDNNYINGSIPLEMFSNCTQLMIFDVSNNMLTGSIPSLISNWTHLQYLFLFNNTFTGAIPREIGNLAQLLSVDMSQNLFTGKIPLNICN

HMMPfam: PF13855
97-157 LRR_8,Leucine rich repeat

ENLTTIDLSHNNLDGAIPANISMLHTLTVLDLSVNNLTGTIPYQLSKLPRLAHLNLGDNHL

FPrintScan: PR00019
99-112 LEURICHRPT,Leucine-rich repeat signature

LTTIDLSHNNLDGA

HMMPfam: PF00560
IPR001611
199-216 LRR_1
Leucine-rich repeat

EHLDLSGNAFSGPIPDSL

HMMPfam: PF13855
221-281 LRR_8,Leucine rich repeat

PNLRHLDLSYNGFHGSIPHSLSRLQKLRELYLHRNNLTRAIPEELGNLTNLEELVLSSNRL

Gene3D: G3DSA:3.80.10.10
250-385 G3DSA:3.80.10.10

LYLHRNNLTRAIPEELGNLTNLEELVLSSNRLVGSLPPSFARMQQLSFFAIDNNYINGSIPLEMFSNCTQLMIFDVSNNMLTGSIPSLISNWTHLQYLFLFNNTFTGAIPREIGNLAQLLSVDMSQNLFTGKIPLN

FPrintScan: PR00019
268-281 LEURICHRPT,Leucine-rich repeat signature

LTNLEELVLSSNRL

superfamily: SSF52058
314-674 SSF52058,LRR

FSNCTQLMIFDVSNNMLTGSIPSLISNWTHLQYLFLFNNTFTGAIPREIGNLAQLLSVDMSQNLFTGKIPLNICNASLLYLVISHNYLEGELPECLWNLKDLGYMDLSSNAFSGEVTTSSNYESSLKSLYLSNNNLSGRFPTVLKNLKNLTVLDLVHNKISGVIPSWIGESNPLLRILRLRSNLFHGSIPCQLSKLSQLQLLDLAENNFTGPVPSSFANLSSMQPETRDKFSSGETYYINIIWKGMEYTFQERDDCVIGIDLSSNSLSGEIPSELTNLRGLQFLNMSRNVLYGGIPNDIGHLHVVESLDLSCNRLLGPIPPSISNLTGLSKLNLSNNLLSGEIPIGNQLQTLDDPSIYANN

Gene3D: G3DSA:3.80.10.10
393-538 G3DSA:3.80.10.10

YLVISHNYLEGELPECLWNLKDLGYMDLSSNAFSGEVTTSSNYESSLKSLYLSNNNLSGRFPTVLKNLKNLTVLDLVHNKISGVIPSWIGESNPLLRILRLRSNLFHGSIPCQLSKLSQLQLLDLAENNFTGPVPSSFANLSSMQP

HMMPfam: PF12799
438-475 LRR_4,Leucine Rich repeats (2 copies)

SLKSLYLSNNNLSGRFPTVLKNLKNLTVLDLVHNKISG

HMMPfam: PF00560
IPR001611
511-533 LRR_1
Leucine-rich repeat

QLQLLDLAENNFTGPVPSSFANL

Gene3D: G3DSA:3.80.10.10
573-676 G3DSA:3.80.10.10

IDLSSNSLSGEIPSELTNLRGLQFLNMSRNVLYGGIPNDIGHLHVVESLDLSCNRLLGPIPPSISNLTGLSKLNLSNNLLSGEIPIGNQLQTLDDPSIYANNLR

HMMPfam: PF00560
IPR001611
619-639 LRR_1
Leucine-rich repeat

ESLDLSCNRLLGPIPPSISNL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox