PRGDB00050063 (unnamed protein product [Oryza sativa Japonica Group].)

From PRG Wiki
Jump to: navigation, search
unnamed protein product [Oryza sativa Japonica Group].
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 9757660 (AP002539)
Gene Class Unknown
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0433F09.

DNA Sequence

ATGATCAAGACACCATCAGTACCACGACGCCTACTGCTCCTCCTACAGCTCTCGTTTCTGCTCCTCCTCAGCTCCGCCAGCAATGCTGTCACGCCGGCTGGGGTGCCATGCCGGCCAGACCAGGCGGCCGCGTTGCTCCGGCTGAAACGCTCATTCGCCGTCACCAGCAACTCCGTCACCGCCTTCCGGTCATGGCGGGCCGGCACCGACTGCTGCGGCTGGGAGGGCGTTGGCTGCGCCGCCGGCGCCGGCGCCAACAATGGCCGCGCCGTGACATCCCTTCATCTGGGTGACTGGGGCTTGGAGAGTGCAGGCATCGACCCTGCACTCTTCGAGCTAACCTCTCTGGAGTATCTAAACCTCGCCTATAACAACTTCGGTGGGTCAAAGATTCCTTCTGATGGATTTGAGCGTCTCATCAGGCTCACACATCTGAATCTTTCCAGCTCTGGATTCACCGGACAGGTGCCAGCCAGCATCGGCAACCTGACGAGTTTGGTATCACTCGACCTTTCCACTTATTTCATGATCGTGGAGATACCCGATGATGCTTATGAGACGCTTATATCTCAAACTGCTAATTCCATATGGCTCATAGAGCCAAATTTTGAAACCTTTATCTCAAAACTCACAAACTTGAGGGATCTCCACCTCGGCTATGTGGACATGTCCAACAGTGGAGCGCAGTGGTGTGATGCTCTAGCCAATTCCTCTCCTAATCTTCAGGTTATTAGCTTACCATTCTGTTCAATCTCTGGCCCTATCTGCCGCTCACTTTCCCTTTTGCAGTCTCTTGCTGCCCTTAACTTGCAACATAACAATCTGTCTGGTCCAATCCCAGACTTCTTGTCAAACTTATCCAATTTGAGTGTTCTCCGACTTAACCATAATGAGCTTGAAGGATGGGTTTCTCCGGCAATCTTTGGACAAAAGAATCTTGTCACAATTGATCTCCACCATAATCTTGGGATCTCTGGTATTCTCCCAAATTTCTCAGCTGACAGTAGGCTGGAGGAATTGCTCGTTGGCCAGACTAATTGCTCGGGTTTAATACCAAGTTCCATTGGAAATCTCAAATTTTTGAAGCAGCTAGACCTCGGTGCGTCTGGTTTTTTTGGAGAGCTGCCCTCATCAATTGCTGTGGTCGATGGAGAATATAACTCATCAGTTTCTCTTCCCCAAATTGTGCTCCTATATTTACCGGGTTGCAGCATGTCTAAGTTCCCTATTTTCTTGAGGCACCAATATGAAATTAATGGCCTCGACCTTTCCGACAACGAAATTAACGGTACTATACCGCATTGGGCATGGGAAACTTGGAATTATATTTCCCTTTTGGGCCTATCCGGCAATAGATTTACGAGTGTGGGATATGACCCTCTTCTTCCCTTACAAGTAGATTTGCTTGATCTTAGCAATAACATGCTTGAAGGGTCCATTCCGATTCCTCGAGGCTCTTCAACATCTCTCAAATATTCAAACAATGGGTTCTCATCCATGCCATCTAATTTTAGTGCTCATCTTAGAGATGTTACCTTTTTCATGGCCGACGGAAATGAAATCTCTGGAAATATTCCTTTGGAGTTTTGCAGTGCTAAGAGTTTACAACTCCTTGATCTGTCTTACAACAACTTCAATGGATCAATCTCTTCTTGTTTAATGGACAGTGTTAGCACGCTGCAAGTATTAAATCTGAAAGGAAATGAACTTCATGGGGTGTTGCCAGACGATATCAAAGAAGGCTGTTCATTTCAGGCATTAGATATTAGCGGAAATTTGATAGAGGGGAAACTACCAAGATCATTAGTTGCTTGCAAAAACTTGGAGGTATTTGATGTTGGGTTCAATCAAATTAGTGACACCTTTCCATGTTGGATGAGTACTCTTCCGAGACTTCAAGTCATTGCCCTCAGATCTAACAAGTTCTTCGGACAGGTCGCACAATCTGCTGTAGAGAAAAATTCTTGTGAATTTCCAGCTGCAAGAATTATTGATCTAGCCTCAAACAACTTCTCGGGTCCATTGCCACAAGATCAATGGTTTAAGAAATTGAAGTCCATGATGATCGGATACTCGAATACGTCATTAGTCATGGATCATGAAGTACCACGAGTAGGAAGGTACAAATTCAGTACTACGATCACATATAAAGGGAGCGCCGTCACATTGACCAAGATTTTGAGGACATTTGTATTCATCGATGTCTCAGAAAACAAATTCCATGGGAGCATTCCAGGGACCATTGGAGAACTTATTCTGTTACACGCACTCAACATGTCACACAACTTCTTGACAGGACCGATTCCATCTCAACTCGGCCATTTGAACCAGTTGGAGGCTTTGGACATGTCCTCAAATGAGCTTTCAGGAGTAATTCCTCAGGAGCTAGCATCCTTGGACTTCCTTGCAATATTGAACCTGTCATACAATAAGCTAGAGGGAAGAATACCACCACAGTCACCTCATTTCTCTACATTCTCCAGCATCTCATTTCTGGGGAACAAGGGTTTGTGCGGCCTTCCTCTGTCGACAGGATGCAGCAACACGACATCTCTGAATGTGATCCCTTCTGAGAAGAATCCTGTAGACATCGTGCTATTCCTTTCTGCTGGACTGGGATTCGGCCTTGGATTTGCCATTGCAATTGTAGTAGCATGGGGAATTCCCATTAGGAAACGGTCCACAGTCACTTGCAGTATATTTGTAATCAAGGCTATGCCATTGCCGTCGCAAGCTAATAATATTCGAATCTTGCATCATATGCAGAGTGACATACTAAAAATTTTACTCAAAGTCACCGGGATTGATTTTCTGAAATCTGACATCTAG


Protein sequences

Name Description Sequence
unnamed protein product [Oryza sativa Japonica Group]. unnamed protein product [Oryza sativa Japonica Group].

MIKTPSVPRRLLLLLQLSFLLLLSSASNAVTPAGVPCRPDQAAALLRLKRSFAVTSNSVTAFRSWRAGTDCCGWEGVGCAAGAGANNGRAVTSLHLGDWGLESAGIDPALFELTSLEYLNLAYNNFGGSKIPSDGFERLIRLTHLNLSSSGFTGQVPASIGNLTSLVSLDLSTYFMIVEIPDDAYETLISQTANSIWLIEPNFETFISKLTNLRDLHLGYVDMSNSGAQWCDALANSSPNLQVISLPFCSISGPICRSLSLLQSLAALNLQHNNLSGPIPDFLSNLSNLSVLRLNHNELEGWVSPAIFGQKNLVTIDLHHNLGISGILPNFSADSRLEELLVGQTNCSGLIPSSIGNLKFLKQLDLGASGFFGELPSSIAVVDGEYNSSVSLPQIVLLYLPGCSMSKFPIFLRHQYEINGLDLSDNEINGTIPHWAWETWNYISLLGLSGNRFTSVGYDPLLPLQVDLLDLSNNMLEGSIPIPRGSSTSLKYSNNGFSSMPSNFSAHLRDVTFFMADGNEISGNIPLEFCSAKSLQLLDLSYNNFNGSISSCLMDSVSTLQVLNLKGNELHGVLPDDIKEGCSFQALDISGNLIEGKLPRSLVACKNLEVFDVGFNQISDTFPCWMSTLPRLQVIALRSNKFFGQVAQSAVEKNSCEFPAARIIDLASNNFSGPLPQDQWFKKLKSMMIGYSNTSLVMDHEVPRVGRYKFSTTITYKGSAVTLTKILRTFVFIDVSENKFHGSIPGTIGELILLHALNMSHNFLTGPIPSQLGHLNQLEALDMSSNELSGVIPQELASLDFLAILNLSYNKLEGRIPPQSPHFSTFSSISFLGNKGLCGLPLSTGCSNTTSLNVIPSEKNPVDIVLFLSAGLGFGLGFAIAIVVAWGIPIRKRSTVTCSIFVIKAMPLPSQANNIRILHHMQSDILKILLKVTGIDFLKSDI

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR26393:SF520
12-921 PTHR26393:SF520

LLLLQLSFLLLLSSASNAVTPAGVPCRPDQAAALLRLKRSFAVTSNSVTAFRSWRAGTDCCGWEGVGCAAGAGANNGRAVTSLHLGDWGLESAGIDPALFELTSLEYLNLAYNNFGGSKIPSDGFERLIRLTHLNLSSSGFTGQVPASIGNLTSLVSLDLSTYFMIVEIPDDAYETLISQTANSIWLIEPNFETFISKLTNLRDLHLGYVDMSNSGAQWCDALANSSPNLQVISLPFCSISGPICRSLSLLQSLAALNLQHNNLSGPIPDFLSNLSNLSVLRLNHNELEGWVSPAIFGQKNLVTIDLHHNLGISGILPNFSADSRLEELLVGQTNCSGLIPSSIGNLKFLKQLDLGASGFFGELPSSIAVVDGEYNSSVSLPQIVLLYLPGCSMSKFPIFLRHQYEINGLDLSDNEINGTIPHWAWETWNYISLLGLSGNRFTSVGYDPLLPLQVDLLDLSNNMLEGSIPIPRGSSTSLKYSNNGFSSMPSNFSAHLRDVTFFMADGNEISGNIPLEFCSAKSLQLLDLSYNNFNGSISSCLMDSVSTLQVLNLKGNELHGVLPDDIKEGCSFQALDISGNLIEGKLPRSLVACKNLEVFDVGFNQISDTFPCWMSTLPRLQVIALRSNKFFGQVAQSAVEKNSCEFPAARIIDLASNNFSGPLPQDQWFKKLKSMMIGYSNTSLVMDHEVPRVGRYKFSTTITYKGSAVTLTKILRTFVFIDVSENKFHGSIPGTIGELILLHALNMSHNFLTGPIPSQLGHLNQLEALDMSSNELSGVIPQELASLDFLAILNLSYNKLEGRIPPQSPHFSTFSSISFLGNKGLCGLPLSTGCSNTTSLNVIPSEKNPVDIVLFLSAGLGFGLGFAIAIVVAWGIPIRKRSTVTCSIFVIKAMPLPSQANNIRILHHM

HMMPanther: PTHR26393
12-921 PTHR26393,FAMILY NOT NAMED

LLLLQLSFLLLLSSASNAVTPAGVPCRPDQAAALLRLKRSFAVTSNSVTAFRSWRAGTDCCGWEGVGCAAGAGANNGRAVTSLHLGDWGLESAGIDPALFELTSLEYLNLAYNNFGGSKIPSDGFERLIRLTHLNLSSSGFTGQVPASIGNLTSLVSLDLSTYFMIVEIPDDAYETLISQTANSIWLIEPNFETFISKLTNLRDLHLGYVDMSNSGAQWCDALANSSPNLQVISLPFCSISGPICRSLSLLQSLAALNLQHNNLSGPIPDFLSNLSNLSVLRLNHNELEGWVSPAIFGQKNLVTIDLHHNLGISGILPNFSADSRLEELLVGQTNCSGLIPSSIGNLKFLKQLDLGASGFFGELPSSIAVVDGEYNSSVSLPQIVLLYLPGCSMSKFPIFLRHQYEINGLDLSDNEINGTIPHWAWETWNYISLLGLSGNRFTSVGYDPLLPLQVDLLDLSNNMLEGSIPIPRGSSTSLKYSNNGFSSMPSNFSAHLRDVTFFMADGNEISGNIPLEFCSAKSLQLLDLSYNNFNGSISSCLMDSVSTLQVLNLKGNELHGVLPDDIKEGCSFQALDISGNLIEGKLPRSLVACKNLEVFDVGFNQISDTFPCWMSTLPRLQVIALRSNKFFGQVAQSAVEKNSCEFPAARIIDLASNNFSGPLPQDQWFKKLKSMMIGYSNTSLVMDHEVPRVGRYKFSTTITYKGSAVTLTKILRTFVFIDVSENKFHGSIPGTIGELILLHALNMSHNFLTGPIPSQLGHLNQLEALDMSSNELSGVIPQELASLDFLAILNLSYNKLEGRIPPQSPHFSTFSSISFLGNKGLCGLPLSTGCSNTTSLNVIPSEKNPVDIVLFLSAGLGFGLGFAIAIVVAWGIPIRKRSTVTCSIFVIKAMPLPSQANNIRILHHM

Gene3D: G3DSA:3.80.10.10
36-227 G3DSA:3.80.10.10

PCRPDQAAALLRLKRSFAVTSNSVTAFRSWRAGTDCCGWEGVGCAAGAGANNGRAVTSLHLGDWGLESAGIDPALFELTSLEYLNLAYNNFGGSKIPSDGFERLIRLTHLNLSSSGFTGQVPASIGNLTSLVSLDLSTYFMIVEIPDDAYETLISQTANSIWLIEPNFETFISKLTNLRDLHLGYVDMSNSG

HMMPfam: PF08263
IPR013210
39-79 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

PDQAAALLRLKRSFAVTSNSVTAFRSWRAGTDCCGWEGVGC

superfamily: SSF52047
93-464 SSF52047,LRR

SLHLGDWGLESAGIDPALFELTSLEYLNLAYNNFGGSKIPSDGFERLIRLTHLNLSSSGFTGQVPASIGNLTSLVSLDLSTYFMIVEIPDDAYETLISQTANSIWLIEPNFETFISKLTNLRDLHLGYVDMSNSGAQWCDALANSSPNLQVISLPFCSISGPICRSLSLLQSLAALNLQHNNLSGPIPDFLSNLSNLSVLRLNHNELEGWVSPAIFGQKNLVTIDLHHNLGISGILPNFSADSRLEELLVGQTNCSGLIPSSIGNLKFLKQLDLGASGFFGELPSSIAVVDGEYNSSVSLPQIVLLYLPGCSMSKFPIFLRHQYEINGLDLSDNEINGTIPHWAWETWNYISLLGLSGNRFTSVGYDPLLPL

HMMPfam: PF13855
106-150 LRR_8,Leucine rich repeat

IDPALFELTSLEYLNLAYNNFGGSKIPSDGFERLIRLTHLNLSSS

Gene3D: G3DSA:3.80.10.10
236-474 G3DSA:3.80.10.10

NSSPNLQVISLPFCSISGPICRSLSLLQSLAALNLQHNNLSGPIPDFLSNLSNLSVLRLNHNELEGWVSPAIFGQKNLVTIDLHHNLGISGILPNFSADSRLEELLVGQTNCSGLIPSSIGNLKFLKQLDLGASGFFGELPSSIAVVDGEYNSSVSLPQIVLLYLPGCSMSKFPIFLRHQYEINGLDLSDNEINGTIPHWAWETWNYISLLGLSGNRFTSVGYDPLLPLQVDLLDLSNN

Gene3D: G3DSA:3.80.10.10
475-548 G3DSA:3.80.10.10

MLEGSIPIPRGSSTSLKYSNNGFSSMPSNFSAHLRDVTFFMADGNEISGNIPLEFCSAKSLQLLDLSYNNFNGS

superfamily: SSF52058
488-575 SSF52058,LRR

TSLKYSNNGFSSMPSNFSAHLRDVTFFMADGNEISGNIPLEFCSAKSLQLLDLSYNNFNGSISSCLMDSVSTLQVLNLKGNELHGVLP

superfamily: SSF52058
548-846 SSF52058,LRR

SISSCLMDSVSTLQVLNLKGNELHGVLPDDIKEGCSFQALDISGNLIEGKLPRSLVACKNLEVFDVGFNQISDTFPCWMSTLPRLQVIALRSNKFFGQVAQSAVEKNSCEFPAARIIDLASNNFSGPLPQDQWFKKLKSMMIGYSNTSLVMDHEVPRVGRYKFSTTITYKGSAVTLTKILRTFVFIDVSENKFHGSIPGTIGELILLHALNMSHNFLTGPIPSQLGHLNQLEALDMSSNELSGVIPQELASLDFLAILNLSYNKLEGRIPPQSPHFSTFSSISFLGNKGLCGLPLSTGC

Gene3D: G3DSA:3.80.10.10
557-689 G3DSA:3.80.10.10

VSTLQVLNLKGNELHGVLPDDIKEGCSFQALDISGNLIEGKLPRSLVACKNLEVFDVGFNQISDTFPCWMSTLPRLQVIALRSNKFFGQVAQSAVEKNSCEFPAARIIDLASNNFSGPLPQDQWFKKLKSMMI

HMMPfam: PF13855
586-641 LRR_8,Leucine rich repeat

ALDISGNLIEGKLPRSLVACKNLEVFDVGFNQISDTFPCWMSTLPRLQVIALRSNK

Gene3D: G3DSA:3.80.10.10
733-843 G3DSA:3.80.10.10

IDVSENKFHGSIPGTIGELILLHALNMSHNFLTGPIPSQLGHLNQLEALDMSSNELSGVIPQELASLDFLAILNLSYNKLEGRIPPQSPHFSTFSSISFLGNKGLCGLPLS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox