PRGDB00050067 (Pi-ta)

From PRG Wiki
Jump to: navigation, search
Pi-ta
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 158836942 (AB364495)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Oryza officinalis

Comment?

Oryza officinalis Pi-ta gene, complete cds, strain: 105314.

DNA Sequence

TGCTGGGCTAAGGAGGTGCGCGAGCTCTCCTACGACGTGGATGACTTCCTCGACGAGCTAACAATCGAGCTCCTCCACTATGACGGCCATGGCAGTAGTAGTACTACTATTGCTGCTGCTGCCAAGAAGACGAGTATGATCGCCCGGCTTCGACGTGAGCTCAAACGGCGGCGATGGATCGCCGACGAAATCACGCGGTTCAGGGCTCGCGTGAAAGAGTCCATTCGCCGGTATGAGAGCTACAATCTTGGCAGGTGCACTGGCTCGAGGCCTACCAAGGACGACGACGACGAACGCAGCCGATTTCTGTCCCTGACGTTAGGGATGGATCTGCACGGCCCGCTTGTTGGTAAGGATAGCTTTATGAAATCGCCCGTCGTGCAGTTGCTCACTGACGGCGAGCCAAAGCTCAAGGTGGGATCGTTTCTTGGATTCGGAGGTGTTGGCAAGACGACGGTGGCCACAGAACTCTATCGTCTGCACGGCCTGCGATTCGACTGCCGGGCTTTCGTCCGGACGTCCCGGAAGCCTGACATGACGAAAATCCTCACCGATATGCTTTCACAACTGCGACCACAACATCGACATCAATCCCCGGACGTTTGGGAGGTTGATCGACTCATTGAAACTATCCGGGCACATTTGCATGATAAGAAGTACTTCATTATAATTGAAGATTTATGGGCTTCATCGACGTGGGATATTATTAGGCGTGGTTTGCCAGAAAATAATCTTTGCAGTAGAATACTAATAACAACAGAAATTGAACCGGTAGCTTTGGCATGTTGTGGTTATAACAGAATGCACCTCATTAAGATTGATCCACTTAATGAAGAATTCTCAAGAAAATTGTTTGTCAGTACAGTTGTTGGTGAAGGAAATGAATTCCCTGAAGATCTTGTAGACATTTCTAATGACATAATAAAAAAATGTGGTGGCTTGCCGCTAGCAATAACAATAACAGCCAGACATTTTAAAAGCCAGTTAGACAGGATGCAGCAATGGAATCACATACAAAATTCAGTGACTTCCAATTTCCAGAAAAATCCTACTATGCAGTGGATGAGACAAGTGCTCAACCTTATTTACAACAATCTTCCCAATTGTTTGAAAGCATGTGTGCTTTATCTTAGCATCTACAAAGACGACTACATAATCAGGAAGGACAACTTGGTGAAACAATGGATGGCTGAAGGTTTCATCAATTCAACAGAAAATAATGATACTGAAGAAGTTGCGGGGAGCTATTTTGATGAACTTGTTAGTAGGGGACTGATCCAACCGGTAGATATTAACTGCAAAAATAAGGTACTGTCCTGTATAGTGCACCACGTGGTACTAAATTTCATCAGATGCAAGTCTGTAGAAGAGAATTTCAGCATTACAATAGATCATTCTCAAACAACATTAAGACATGCTGATAAGGTTCGGCGACTGTCTCTTCACTTTGGCAATGCACAAGATACAACTCCACTAGCAGGTTTGAGGTTATCACAAGTTCGATCAATGGCCTTTCTTGGGCAAGTGAAGTGTATGCCTTCCATTGCAGGGTATAGGCTTCTTCGAGTTCTTATTCTTCATTTTTGTGATGATCAAGAAAAAACCAGCTGCGACCTCACTTGGATTTCTGAACTATTTCAGCTGAGATGTCTGAAGATTACAGGTAATATCACGGCTAAACTTCCAGAACGGATTCAGGGACTACGATACTTGCAGACATTGGAAGTAGATGCAAGAATAGGTAGTGTCCCAGTGGATATTGTTCATTCCAAGGATTTGCTGCACCTTCGTCTTGTACTGCTTGAGCTGCTCCCTCACTATCAAAGCCACAGGTACATAATCCCCAGCCTCCCCGAATGGACTGGAAAGCTCGATAAGCTCCGCGTTTTAAACATTGCAGTCATGCAGTTTTCTCATGAAGATCTTGATACCCTCAAAGGACTGGCTGCTCTCACTGCTCTCTCGCTTCATGTCAAAACAGCACCTGCACAAAGGATTGTCGTCCCCGATGGGGAGTTCTTGGCTCTCAAGTACTTCATGTTCGTCTGTACTGCACCATGCATTACCTTTGTGCAAGGAGCAATGCCTAGTGTACAGAGGTTAAATCTAAGGTTCAATGCCA



Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017:SF126
5-526 PTHR11017:SF126,OS11G0237600 PROTEIN

EVRELSYDVDDFLDELTIELLHYDGHGSSSTTIAAAAKKTSMIARLRRELKRRRWIADEITRFRARVKESIRRYESYNLGRCTGSRPTKDDDDERSRFLSLTLGMDLHGPLVGKDSFMKSPVVQLLTDGEPKLKVGSFLGFGGVGKTTVATELYRLHGLRFDCRAFVRTSRKPDMTKILTDMLSQLRPQHRHQSPDVWEVDRLIETIRAHLHDKKYFIIIEDLWASSTWDIIRRGLPENNLCSRILITTEIEPVALACCGYNRMHLIKIDPLNEEFSRKLFVSTVVGEGNEFPEDLVDISNDIIKKCGGLPLAITITARHFKSQLDRMQQWNHIQNSVTSNFQKNPTMQWMRQVLNLIYNNLPNCLKACVLYLSIYKDDYIIRKDNLVKQWMAEGFINSTENNDTEEVAGSYFDELVSRGLIQPVDINCKNKVLSCIVHHVVLNFIRCKSVEENFSITIDHSQTTLRHADKVRRLSLHFGNAQDTTPLAGLRLSQVRSMAFLGQVKCMPSIAGYRLLRVLIL

HMMPanther: PTHR11017
5-526 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

EVRELSYDVDDFLDELTIELLHYDGHGSSSTTIAAAAKKTSMIARLRRELKRRRWIADEITRFRARVKESIRRYESYNLGRCTGSRPTKDDDDERSRFLSLTLGMDLHGPLVGKDSFMKSPVVQLLTDGEPKLKVGSFLGFGGVGKTTVATELYRLHGLRFDCRAFVRTSRKPDMTKILTDMLSQLRPQHRHQSPDVWEVDRLIETIRAHLHDKKYFIIIEDLWASSTWDIIRRGLPENNLCSRILITTEIEPVALACCGYNRMHLIKIDPLNEEFSRKLFVSTVVGEGNEFPEDLVDISNDIIKKCGGLPLAITITARHFKSQLDRMQQWNHIQNSVTSNFQKNPTMQWMRQVLNLIYNNLPNCLKACVLYLSIYKDDYIIRKDNLVKQWMAEGFINSTENNDTEEVAGSYFDELVSRGLIQPVDINCKNKVLSCIVHHVVLNFIRCKSVEENFSITIDHSQTTLRHADKVRRLSLHFGNAQDTTPLAGLRLSQVRSMAFLGQVKCMPSIAGYRLLRVLIL

HMMPfam: PF00931
IPR002182
125-404 NB-ARC,NBS
NB-ARC

PVVQLLTDGEPKLKVGSFLGFGGVGKTTVATELYRLHGLRFDCRAFVRTSRKPDMTKILTDMLSQLRPQHRHQSPDVWEVDRLIETIRAHLHDKKYFIIIEDLWASSTWDIIRRGLPENNLCSRILITTEIEPVALACCGYNRMHLIKIDPLNEEFSRKLFVSTVVGEGNEFPEDLVDISNDIIKKCGGLPLAITITARHFKSQLDRMQQWNHIQNSVTSNFQKNPTMQWMRQVLNLIYNNLPNCLKACVLYLSIYKDDYIIRKDNLVKQWMAEGFINST

superfamily: SSF52540
135-349 SSF52540

PKLKVGSFLGFGGVGKTTVATELYRLHGLRFDCRAFVRTSRKPDMTKILTDMLSQLRPQHRHQSPDVWEVDRLIETIRAHLHDKKYFIIIEDLWASSTWDIIRRGLPENNLCSRILITTEIEPVALACCGYNRMHLIKIDPLNEEFSRKLFVSTVVGEGNEFPEDLVDISNDIIKKCGGLPLAITITARHFKSQLDRMQQWNHIQNSVTSNFQKN

FPrintScan: PR00364
IPR000767
139-154 DISEASERSIST
Disease resistance protein

VGSFLGFGGVGKTTVA

FPrintScan: PR00364
IPR000767
214-228 DISEASERSIST
Disease resistance protein

HLHDKKYFIIIEDLW

FPrintScan: PR00364
IPR000767
311-325 DISEASERSIST
Disease resistance protein

CGGLPLAITITARHF

superfamily: SSF52058
425-706 SSF52058,LRR

LIQPVDINCKNKVLSCIVHHVVLNFIRCKSVEENFSITIDHSQTTLRHADKVRRLSLHFGNAQDTTPLAGLRLSQVRSMAFLGQVKCMPSIAGYRLLRVLILHFCDDQEKTSCDLTWISELFQLRCLKITGNITAKLPERIQGLRYLQTLEVDARIGSVPVDIVHSKDLLHLRLVLLELLPHYQSHRYIIPSLPEWTGKLDKLRVLNIAVMQFSHEDLDTLKGLAALTALSLHVKTAPAQRIVVPDGEFLALKYFMFVCTAPCITFVQGAMPSVQRLNLRFN

Gene3D: G3DSA:3.80.10.10
478-584 G3DSA:3.80.10.10

RLSLHFGNAQDTTPLAGLRLSQVRSMAFLGQVKCMPSIAGYRLLRVLILHFCDDQEKTSCDLTWISELFQLRCLKITGNITAKLPERIQGLRYLQTLEVDARIGSVP

Gene3D: G3DSA:3.80.10.10
618-657 G3DSA:3.80.10.10

PEWTGKLDKLRVLNIAVMQFSHEDLDTLKGLAALTALSLH






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox